Alignments for a candidate for ramA in Desulfatibacillum aliphaticivorans DSM 15576

GapMind for Amino acid biosynthesis

Alignments for a candidate for ramA in Desulfatibacillum aliphaticivorans DSM 15576

Align candidate WP_028316647.1 G491_RS0126315 (hypothetical protein)
to HMM PF14574 (RACo_C_ter)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF14574.10.hmm
# target sequence database:        /tmp/gapView.20225.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       RACo_C_ter  [M=261]
Accession:   PF14574.10
Description: C-terminal domain of RACo the ASKHA domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    2.8e-72  229.0   2.0    4.1e-72  228.5   2.0    1.2  1  lcl|NCBI__GCF_000429905.1:WP_028316647.1  G491_RS0126315 hypothetical prot


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000429905.1:WP_028316647.1  G491_RS0126315 hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  228.5   2.0   4.1e-72   4.1e-72       3     251 ..     277     517 ..     275     520 .] 0.95

  Alignments for each domain:
  == domain 1  score: 228.5 bits;  conditional E-value: 4.1e-72
                                RACo_C_ter   3 slliDiGTNaEivlgnkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvignek. 70 
                                               +lliD+GTN+E+ ++n+   +aas+a+GPA+EG+e+ cGm+A+pgAi+ v+i+ ++   +l+vig +  
  lcl|NCBI__GCF_000429905.1:WP_028316647.1 277 ALLIDLGTNGELLFKNNGSFYAASCATGPAFEGAELDCGMQATPGAINGVKINGDQKVASLSVIGANGg 345
                                               69**************************************************************64434 PP

                                RACo_C_ter  71 ....pkGicGsGiidliaelleagiidkkgklnkelkserireeeeteeyvlvlaeesetekdivitek 135
                                                   p GicG G+i+++ael+++g++++ g ++            ++ e+vl   + ++ +++++i++k
  lcl|NCBI__GCF_000429905.1:WP_028316647.1 346 dgvqPAGICGPGVINALAELYRKGVVKSGGGFK-----------AGEREFVLFGGDPNNGNHSVYISQK 403
                                               4445****************************3...........4789****9999999999******* PP

                                RACo_C_ter 136 DidelirakaAiyagvktLleevglevedidkvylaGafGsyidlekAitiGllPdlelekvkqvGNts 204
                                               Di++++  k+A+ +g+++Ll e+g  + + +k+++aGafG++++ e+ i +G++Pdl+ ek++ +GN++
  lcl|NCBI__GCF_000429905.1:WP_028316647.1 404 DIRSIQLGKGALATGIEFLLMEAG--LVQPEKILIAGAFGNHLNKEDIICLGMIPDLKSEKIEMAGNSA 470
                                               ************************..8899*************************************** PP

                                RACo_C_ter 205 lagAraallsreareeleeiarkityielavekkFmeefvaalflph 251
                                               +agA +al+++  ++++ e+a+ki+ i+la + +F+++fv +l++p+
  lcl|NCBI__GCF_000429905.1:WP_028316647.1 471 GAGAVMALCDDLYLQKAIEMAKKIQTIDLAGNVEFQKKFVYNLSFPE 517
                                               ********************************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (261 nodes)
Target sequences:                          1  (520 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 11.61
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer
changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for Amino acid biosynthesis