Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_028320091.1 H567_RS0101850 LL-diaminopimelate aminotransferase
Query= BRENDA::A0LEA5 (388 letters) >NCBI__GCF_000422285.1:WP_028320091.1 Length = 389 Score = 558 bits (1437), Expect = e-163 Identities = 260/385 (67%), Positives = 322/385 (83%) Query: 3 FVKAERLKLLPPYLFQEIDRLKAELTAKGVDVINLGVGDPDLPTPDHIIARLKTAAEDPS 62 F +AERLK LPPYLF+EIDR KAE+ A+GVD+I+LGVGDPDLPTP HII LK A EDP Sbjct: 4 FERAERLKRLPPYLFKEIDRKKAEVKARGVDIIDLGVGDPDLPTPPHIIEVLKKAVEDPG 63 Query: 63 THQYPSYSGMNDFKVSVAGWYKRRFGVELDPLSEVLTLIGSKEGLAHFPLAVINPGDLAL 122 H+YPSYSGM FK +VA WY RRFGV+LDP +EV++LIGSKEG+AHFPLA I+PGD+AL Sbjct: 64 NHRYPSYSGMGGFKEAVAEWYGRRFGVQLDPKTEVVSLIGSKEGIAHFPLAFIDPGDVAL 123 Query: 123 VPTPAYPVYHVATMFAGGESYFMPLVRENGFLPDLDSIPADVARRAKVMFINYPNNPTGA 182 VPTPAYPVYH+ATMFAGGESYFMPL+++N FLPDLD+IP +VA RA++MFINYPNNPT A Sbjct: 124 VPTPAYPVYHIATMFAGGESYFMPLLKKNDFLPDLDAIPGEVAGRARMMFINYPNNPTAA 183 Query: 183 TAERDFFEKVIAFAREYDVIVCHDAAYTEMAFGGYRPLSFLELPGAGEVGVEFHSLSKTY 242 A+R FFE+V+AFA++ ++IVCHDAAYTEM + GY+P SFLE+PGA +VG+EFHSLSKTY Sbjct: 184 VADRAFFERVVAFAKDKNLIVCHDAAYTEMGYDGYQPPSFLEVPGAKDVGLEFHSLSKTY 243 Query: 243 NMTGWRLGFAVGNADILAGLGQVKSNIDSGAFNAVQWAGITALEGDQGCVVEMQRIYKER 302 NMTGWR+GFAVGN + + GLG +KSNIDSG F AVQ AGI A+ GDQ CV EM+ +Y R Sbjct: 244 NMTGWRIGFAVGNREAVDGLGAIKSNIDSGVFQAVQMAGIEAIAGDQACVDEMRTVYTRR 303 Query: 303 LDILIEGLKRIGLHPEVPRATFYVWCPTPPGYSSKDFSSLLLREAGIVATPGSGFGAPGE 362 D++++GL++ G VPRATFY+W P GY+S ++ LL EAG+V TPG+GFG PGE Sbjct: 304 RDLMVKGLEKAGFRLRVPRATFYLWVEVPAGYTSAQVATRLLEEAGLVVTPGNGFGEPGE 363 Query: 363 GYIRMALTVDKERVREAVERMRKLS 387 GY R+ALT ++ER+ EA+ER++KL+ Sbjct: 364 GYFRIALTQNRERLAEAIERLQKLN 388 Lambda K H 0.321 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 28 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 389 Length adjustment: 30 Effective length of query: 358 Effective length of database: 359 Effective search space: 128522 Effective search space used: 128522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_028320091.1 H567_RS0101850 (LL-diaminopimelate aminotransferase)
to HMM TIGR03540 (LL-diaminopimelate aminotransferase (EC 2.6.1.83))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03540.hmm # target sequence database: /tmp/gapView.2927.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03540 [M=383] Accession: TIGR03540 Description: DapC_direct: LL-diaminopimelate aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-195 635.3 0.0 1.9e-195 635.1 0.0 1.0 1 lcl|NCBI__GCF_000422285.1:WP_028320091.1 H567_RS0101850 LL-diaminopimelat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000422285.1:WP_028320091.1 H567_RS0101850 LL-diaminopimelate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 635.1 0.0 1.9e-195 1.9e-195 2 382 .. 6 386 .. 5 387 .. 1.00 Alignments for each domain: == domain 1 score: 635.1 bits; conditional E-value: 1.9e-195 TIGR03540 2 laerleklPPylfaeidklkaekkakGvdvidlgiGdPdlptpkeivealkkaaekpenhryPsyeGll 70 aerl++lPPylf eid++kae+ka+Gvd+idlg+GdPdlptp +i+e lkka+e+p nhryPsy+G+ lcl|NCBI__GCF_000422285.1:WP_028320091.1 6 RAERLKRLPPYLFKEIDRKKAEVKARGVDIIDLGVGDPDLPTPPHIIEVLKKAVEDPGNHRYPSYSGMG 74 69******************************************************************* PP TIGR03540 71 ayrkavadwykkrfgveldpetevlsliGskeGiahlplafvnpGdivlvpdPgyPvykistllaggep 139 +++ava+wy +rfgv+ldp+tev+sliGskeGiah+plaf++pGd++lvp P+yPvy+i+t++agge+ lcl|NCBI__GCF_000422285.1:WP_028320091.1 75 GFKEAVAEWYGRRFGVQLDPKTEVVSLIGSKEGIAHFPLAFIDPGDVALVPTPAYPVYHIATMFAGGES 143 ********************************************************************* PP TIGR03540 140 yelPlkeendflPdldaipedvlkkakilflnyPnnPtsavadkeffkevvefakeyniivvhdaayse 208 y +Pl+++ndflPdldaip +v+ +a+++f+nyPnnPt+avad+ ff++vv+fak++n+iv+hdaay+e lcl|NCBI__GCF_000422285.1:WP_028320091.1 144 YFMPLLKKNDFLPDLDAIPGEVAGRARMMFINYPNNPTAAVADRAFFERVVAFAKDKNLIVCHDAAYTE 212 ********************************************************************* PP TIGR03540 209 ivfdeykalsflevdgakdvaielhslsktynmtGWrigfavGnkeliaalgkvksnvdsGvfqaiqea 277 + +d+y+++sflev+gakdv++e+hslsktynmtGWrigfavGn+e +++lg +ksn+dsGvfqa+q a lcl|NCBI__GCF_000422285.1:WP_028320091.1 213 MGYDGYQPPSFLEVPGAKDVGLEFHSLSKTYNMTGWRIGFAVGNREAVDGLGAIKSNIDSGVFQAVQMA 281 ********************************************************************* PP TIGR03540 278 aiaaleeeeevvkelrkvykkrrdllvealkkiGldvkkpkatfylWvkvPeGytsaefakklleeagv 346 +i+a+ +++++v+e+r vy +rrdl+v++l+k G+ ++ p+atfylWv+vP+Gytsa+ a++lleeag+ lcl|NCBI__GCF_000422285.1:WP_028320091.1 282 GIEAIAGDQACVDEMRTVYTRRRDLMVKGLEKAGFRLRVPRATFYLWVEVPAGYTSAQVATRLLEEAGL 350 ********************************************************************* PP TIGR03540 347 vvtpGvgfGesGeGyirisltvseerlkeaverlkk 382 vvtpG+gfGe GeGy+ri+lt+++erl+ea+erl+k lcl|NCBI__GCF_000422285.1:WP_028320091.1 351 VVTPGNGFGEPGEGYFRIALTQNRERLAEAIERLQK 386 **********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (383 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory