Align Homocysteine formation from aspartate semialdehyde (COG2122 or apbE like component) (characterized)
to candidate WP_028320966.1 H567_RS0107765 UPF0280 family protein
Query= reanno::Miya:8499265 (277 letters) >NCBI__GCF_000422285.1:WP_028320966.1 Length = 242 Score = 149 bits (376), Expect = 6e-41 Identities = 98/249 (39%), Positives = 129/249 (51%), Gaps = 18/249 (7%) Query: 28 RGYRKRTARHPDEVVFQVVVEETDLWVTARSGLSGQPGQPVQPDLPDRIAAYVTELRGQI 87 R YR + AR F V V +TDLWV A S LP+ + V E R QI Sbjct: 7 RDYRLK-ARAKGLTSFGVAVRQTDLWVQAES------------PLPEETRSLVLEARRQI 53 Query: 88 KAWMLLAPDFRTSLVPVPTPASAPEVARRMAHGADIAGVGPFAAVAGTVAQMVAERFAPV 147 ++ + P+F +L+P AP + + M AGVGP AAVAG VAQ V E Sbjct: 54 ESHISEHPEFLDALLPQKEDMFAPPLVKVMLRAGRAAGVGPMAAVAGAVAQYVGEGLLEF 113 Query: 148 SPDIIVENGGDIYICSQRDRVVGLL--PDPASGEMIGVVVKAADCPVSLCSSSATIGHSL 205 SP +IVENGGDI++ +QRD V + P SG +G+ V + P+ +C+SS ++GHSL Sbjct: 114 SPQVIVENGGDIFLATQRDATVAIYAGKSPLSGR-VGIRVPSERMPLGVCTSSGSVGHSL 172 Query: 206 SLGVGNIAAVRARDASLADAAATLFGNMLQGPDDVARVTERAAAMAHLGIEGVYAQCGGR 265 SLG + + R A+LADAAAT GN L D+A A+ M GI G R Sbjct: 173 SLGESDAVCIVCRSAALADAAATALGNRLVKSADLACAAREASGMP--GILGGVLILKDR 230 Query: 266 VGIWGNMEL 274 + WG EL Sbjct: 231 LASWGEFEL 239 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 277 Length of database: 242 Length adjustment: 24 Effective length of query: 253 Effective length of database: 218 Effective search space: 55154 Effective search space used: 55154 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory