Align [corrinoid iron-sulfur protein]-dependent methionine synthase (characterized)
to candidate WP_028321197.1 H567_RS0109315 hypothetical protein
Query= metacyc::MONOMER-21502 (342 letters) >NCBI__GCF_000422285.1:WP_028321197.1 Length = 350 Score = 235 bits (600), Expect = 1e-66 Identities = 129/339 (38%), Positives = 191/339 (56%), Gaps = 12/339 (3%) Query: 5 DFHFLPTMIGSMPHTDPKAAVDIITHYLQDIPVWPQLPRRSCLEGMSAQFSQGLP--GVK 62 DFHF+ T IGS+P TD + + I +P WPQ PRRS +E MS QFS+G+P Sbjct: 7 DFHFIATGIGSVPFTDIASTCNGILREAPRMPFWPQFPRRSPVEDMSIQFSEGMPLLSAD 66 Query: 63 INQDKVWIEPNPSFESELESLYQAYLDNDFNKFPIGAEYAAGLY----ELASRNLSPL-L 117 + + I+ + L + Y ++ +D F + EYA GLY LA R Sbjct: 67 LENRSLAIDSDTPQADALVAFYDRFMSHDVEAFALSREYAPGLYWMADSLADRPADEGGF 126 Query: 118 VKGHITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKATWQEHFLRNICRNTIIFVD 177 KG GP+T+ I+D +G +L++ L +A T L +KA WQ L + R +IF+D Sbjct: 127 FKGQTVGPVTFAAGIRDTNGTSVLHNPELLEALTHALAIKARWQVGALASSGRQPVIFLD 186 Query: 178 EPAMSAYGSAYLPLSREQVTGMF----DEVFSGISGLKGVHCCGNTDWSILMDTRVDIIN 233 EP +S +GSA+ P+ RE V + D + + L G+HCCGNTDWS++++ DI+N Sbjct: 187 EPYLSGFGSAFSPIQRETVIELLRIVIDYLRTHTDTLIGIHCCGNTDWSMILEAEPDIVN 246 Query: 234 FDTYAYANSLSIYTDEVKAFIKRGGAVAWGIVPTDEKALKEETAASLKDRLEAAMSHFDS 293 FD + + + +Y D ++ F+ GGAVAWGIVPT A+ E T SL RL +++ + Sbjct: 247 FDAFEHLDYFLLYPDHIRKFLLAGGAVAWGIVPT-SPAVMEATFDSLASRLRKGLAYLEE 305 Query: 294 HGLPFAELARHSLITPACGLGLKSPEAAERAPQLLAELS 332 G+ + LA+ SL+TPACG+G + A +A +LL LS Sbjct: 306 KGIDRSLLAQRSLLTPACGMGSMTEREARKALELLGMLS 344 Lambda K H 0.319 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 350 Length adjustment: 29 Effective length of query: 313 Effective length of database: 321 Effective search space: 100473 Effective search space used: 100473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory