Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_028321431.1 H567_RS0110915 hypothetical protein
Query= BRENDA::Q939C9 (436 letters) >NCBI__GCF_000422285.1:WP_028321431.1 Length = 436 Score = 444 bits (1142), Expect = e-129 Identities = 221/437 (50%), Positives = 296/437 (67%), Gaps = 8/437 (1%) Query: 1 MNDAAKELNRTLSEENPHVLHMLSDLGRELFYPKGVLTQSAEAKAKAGKYNATIGIATSQ 60 MN A+ELN L NPHV MLS +GR LF+PKG+L QSAEAK KA ++NATIG+AT + Sbjct: 1 MNPIAQELNEILRRANPHVFDMLSQVGRNLFFPKGILAQSAEAKQKAHRFNATIGMATEK 60 Query: 61 GESMHFSHIQETLSAYNPDDIYDYAPPQGKEPLRQEWLKKMRLENPSLAGKDISTPIVTN 120 GE+M+ + +++ + YAP G LRQ W + + +NPSL GK +S PIVTN Sbjct: 61 GETMYLPSVMASIAGLTAEQALTYAPSFGIPKLRQVWQEGLFAKNPSLKGKTVSLPIVTN 120 Query: 121 ALTHGLSIAADLFVNEGDTLLLPDKYWGNYNFIFGVRRKASIETYPLFQQDGRFNAAGLS 180 A+THGLS+ AD++ + GD L+LPDK WGNYN IFGVRR A + Y LF + G FN Sbjct: 121 AITHGLSVIADMWADPGDVLILPDKMWGNYNMIFGVRRGAEVVNYSLFDEAGAFNLGAFE 180 Query: 181 ELLKKQ---EEKAIVVLNFPNNPTGYTPGEEEASEIVSVILEAAEAGKEIVVLVDDAYYN 237 E ++K+ +K I++LNFPNNPTGYT EA I ++ AEAG ++ + DDAY+ Sbjct: 181 ECVRKEAAARKKLIIILNFPNNPTGYTVSAAEADRIGEILTAVAEAGTNVLAVTDDAYFG 240 Query: 238 LFYDETAIQESIFSKLAQVHDRVLCVKIDGATKENYAWGFRVGFITYS---TKSEK-ALR 293 LFYDETA +ES+F++L H R+L VK+DGATKEN+ WG RVGFITY + EK A Sbjct: 241 LFYDETASKESVFTRLVDRHPRLLAVKLDGATKENFVWGLRVGFITYGGVFLEDEKGACD 300 Query: 294 VLEEKTKGIIRGTISSAPHPSQTFMLRAMQSPEYEKEKSLKYNIMKKRADKVKAVLAENK 353 LE KT G +RG+IS+A SQ +L+A+ SP Y EK K+ IM RA +VK VL + K Sbjct: 301 ALERKTAGDVRGSISNASRLSQEIVLKALLSPGYPAEKEQKFQIMAGRAREVKRVLQDPK 360 Query: 354 HYEDVWTPYPFNSGYFMCVRLKDINAGELRVSLLEKRGIGTISINETDLRIAFSCVEEEH 413 Y+D W YPFNSGYFMC++LK ++A +LR LL++ G+G I++ +TDLR+AFSC+EEE Sbjct: 361 -YQDAWDVYPFNSGYFMCLKLKTVDAEQLRAHLLDQYGVGLIALGKTDLRVAFSCLEEED 419 Query: 414 IADLFEEIYQEAKQLQK 430 + LF+ + + L+K Sbjct: 420 VQALFDAVLSGIRDLEK 436 Lambda K H 0.315 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 436 Length adjustment: 32 Effective length of query: 404 Effective length of database: 404 Effective search space: 163216 Effective search space used: 163216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory