Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate WP_028321758.1 H567_RS0113165 carbamoyl-phosphate synthase small subunit
Query= SwissProt::Q9LVW7 (430 letters) >NCBI__GCF_000422285.1:WP_028321758.1 Length = 383 Score = 359 bits (922), Expect = e-104 Identities = 179/376 (47%), Positives = 251/376 (66%), Gaps = 7/376 (1%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A L LEDG+++P +SF P + E+VFNTS++GYQE+LTDPSY GQ V MT P +GN G Sbjct: 3 ALLALEDGTLFPGRSFTGPAEAVGEVVFNTSMSGYQEVLTDPSYCGQMVTMTYPLMGNYG 62 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 VN +D ES + + ++R SNWR +LA+YLT I G+ +DTRA+TR LR Sbjct: 63 VNDEDVESDRIQVRAFLVREYQEYPSNWRSKGSLAEYLTAAGIPGLEGIDTRALTRHLRV 122 Query: 178 DGSLIGVLSTEQSKTDDELLQMSRSWDIVGIDLISDVSCKSPYEWVDKTNAEWD-----F 232 G++ G LST + + ++ D++G+DL+ +V+C+ P W + + + F Sbjct: 123 SGAMRGALSTRDLDPHSLVEKARQAPDMLGLDLVREVTCRRPMLWTEGNPSPIEGGLEGF 182 Query: 233 NTNSRDGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGP 292 R G +++V+A DFG+K NILR L+ GC I +VP+ P A +++PDG+ SNGP Sbjct: 183 RWPERPG-AWRVVAMDFGVKYNILRSLAQRGCTILMVPADTPGALIDRLDPDGLFLSNGP 241 Query: 293 GDPSAVPYAVETVKELLGKVPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRTG 352 GDP+AV Y + ++++ LGK P++GIC+GHQL+G ALGG +FK+KFGH GGN PV++ TG Sbjct: 242 GDPAAVTYGIASIRDQLGKRPIFGICLGHQLIGLALGGTSFKLKFGHRGGNQPVQDLTTG 301 Query: 353 QVEISAQNHNYAVDPASL-PGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPHD 411 +VEI++QNH + VD SL VEVTHVNLNDG+ GL + + S+QYHPEASPGPHD Sbjct: 302 KVEITSQNHGFCVDMGSLAEKDVEVTHVNLNDGTLEGLVHKRIPLFSVQYHPEASPGPHD 361 Query: 412 SDNAFREFIELMKRSK 427 + F FI LMKR + Sbjct: 362 AAYLFDRFIALMKRHR 377 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 383 Length adjustment: 31 Effective length of query: 399 Effective length of database: 352 Effective search space: 140448 Effective search space used: 140448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_028321758.1 H567_RS0113165 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.26374.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-153 497.5 0.0 1.2e-153 497.3 0.0 1.0 1 lcl|NCBI__GCF_000422285.1:WP_028321758.1 H567_RS0113165 carbamoyl-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000422285.1:WP_028321758.1 H567_RS0113165 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 497.3 0.0 1.2e-153 1.2e-153 1 360 [. 3 374 .. 3 375 .. 0.97 Alignments for each domain: == domain 1 score: 497.3 bits; conditional E-value: 1.2e-153 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a l+ledGt f g+sf + e+vGevvFnTsm+GYqE+ltDpsY gq+v++typl+gnygvn+ed+es+ lcl|NCBI__GCF_000422285.1:WP_028321758.1 3 ALLALEDGTLFPGRSFTGPAEAVGEVVFNTSMSGYQEVLTDPSYCGQMVTMTYPLMGNYGVNDEDVESD 71 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeel 138 +i+v++++v+e+++ +sn+r+k sL+e+l+ gi+++eg+DTRal+++lR +g+m++++st++ + ++l lcl|NCBI__GCF_000422285.1:WP_028321758.1 72 RIQVRAFLVREYQEYPSNWRSKGSLAEYLTAAGIPGLEGIDTRALTRHLRVSGAMRGALSTRDLDPHSL 140 ********************************************************************* PP TIGR01368 139 vekakespkvkevnlvkevstkeayeleq..........k....akkegkklrvvvidlGvKenilreL 193 veka+++p++ +++lv+ev++++++ +++ + ++ g rvv++d+GvK nilr+L lcl|NCBI__GCF_000422285.1:WP_028321758.1 141 VEKARQAPDMLGLDLVREVTCRRPMLWTEgnpspiegglEgfrwPERPGA-WRVVAMDFGVKYNILRSL 208 ****************************9887777665516543344444.69**************** PP TIGR01368 194 vkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllala 262 ++rg+++ +vpadt+ + i +l+pdg++lsnGPGdPaav++ i+ ++ l+ k PifGIclGhql++la lcl|NCBI__GCF_000422285.1:WP_028321758.1 209 AQRGCTILMVPADTPGALIDRLDPDGLFLSNGPGDPAAVTYGIASIRDQLG-KRPIFGICLGHQLIGLA 276 ***************************************************.***************** PP TIGR01368 263 lgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelp 331 lg+ +klkfGhrG+N+pv+dl+tg+veitsqNHg+ vd sl e+++evthvnlnDgt+egl hk++p lcl|NCBI__GCF_000422285.1:WP_028321758.1 277 LGGTSFKLKFGHRGGNQPVQDLTTGKVEITSQNHGFCVDMGSLAEKDVEVTHVNLNDGTLEGLVHKRIP 345 ********************************************************************* PP TIGR01368 332 vfsvQyHPeaspGphdteylFdefvelik 360 +fsvQyHPeaspGphd++ylFd+f+ l+k lcl|NCBI__GCF_000422285.1:WP_028321758.1 346 LFSVQYHPEASPGPHDAAYLFDRFIALMK 374 **************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (383 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory