Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_028485384.1 A377_RS0108115 homoserine O-acetyltransferase
Query= SwissProt::D7E9E0 (489 letters) >NCBI__GCF_000384235.1:WP_028485384.1 Length = 380 Score = 380 bits (977), Expect = e-110 Identities = 191/368 (51%), Positives = 255/368 (69%), Gaps = 6/368 (1%) Query: 4 KSIGNVETKYYQIPEELVLESGKKISDVTLAYETYGTLNWDKSNAILVCHALTGDAHAAG 63 +SIG V + + L + G ++ L YETYG LN D SNA+L+CHAL+G+ H AG Sbjct: 3 ESIGLVAPETLHVTTPLDMVCGARLPQYDLTYETYGQLNADASNAVLICHALSGNHHVAG 62 Query: 64 WHEGDRKPGWWDIIIGPGKALDTRKYFIICSNVIGGCKGSTGPSSINPDTGESYGLDFPV 123 ++ ++ GWWD IGPGK +DT ++F++CSN +GGC GS+GP+SINP+TG+ +G DFP+ Sbjct: 63 HYDEEKSQGWWDQYIGPGKPIDTNRFFVVCSNNLGGCHGSSGPASINPETGDVFGPDFPI 122 Query: 124 VTIKDMVNAQKKLIDYLGISKLLAVIGGSMGGLQVLQWSVSYPDMVKKAIPIATAGYSTP 183 VT KD VN+Q L DYLGI AVIGGSMGG+QV+QW++ YPD ++ A+ IA A + Sbjct: 123 VTCKDWVNSQNVLRDYLGIDAWAAVIGGSMGGMQVMQWAMDYPDRLRHALVIAAAPKLSA 182 Query: 184 QQIAFNEVGRIAIVSDPNWNSGNYY-GEKEPTHGLALARMIGHITYLSDDSMHQKFGRRL 242 Q IAFNEV R AI++DP ++ G + P GLALARM+GH+TYLSDD M KFGR L Sbjct: 183 QNIAFNEVARRAIMTDPEFHHGRFIEAGTTPKRGLALARMLGHLTYLSDDMMGSKFGREL 242 Query: 243 QDKNEYEFDFSREFEVESYLHYQGLTFT--ERFDANSYLYLTKAIDYFDLTE--NNSLAE 298 ++ + +++F EF+VESYL YQG F + FDAN+YL +TKA+DYFD +NSLA+ Sbjct: 243 RE-GKLKYNFDVEFQVESYLRYQGEKFATKQNFDANTYLLMTKALDYFDPAAEFDNSLAK 301 Query: 299 GLKNVEAKFLVISFTSDWLYPPYQLREIVMALSANNADVTYREIESNYGHDSFLLESGQL 358 L AKFLVISFTSDW + P + +EIV AL N+ADVTY EI S +GHD+FLL + Sbjct: 302 ALAQTTAKFLVISFTSDWRFSPKRSQEIVKALLDNDADVTYAEINSKHGHDAFLLPNAHY 361 Query: 359 NYVLNNFL 366 V ++ Sbjct: 362 EGVFRAYM 369 Lambda K H 0.316 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 380 Length adjustment: 32 Effective length of query: 457 Effective length of database: 348 Effective search space: 159036 Effective search space used: 159036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_028485384.1 A377_RS0108115 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.13524.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-144 465.4 0.0 6.7e-144 465.2 0.0 1.0 1 lcl|NCBI__GCF_000384235.1:WP_028485384.1 A377_RS0108115 homoserine O-acet Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384235.1:WP_028485384.1 A377_RS0108115 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.2 0.0 6.7e-144 6.7e-144 3 350 .. 17 369 .. 15 370 .. 0.97 Alignments for each domain: == domain 1 score: 465.2 bits; conditional E-value: 6.7e-144 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 ++l + +G+ l++++++y+tyG+lna+ +Navl+cHal+g++hvag++dee++ GWWd+++Gpg+++dt lcl|NCBI__GCF_000384235.1:WP_028485384.1 17 TPLDMVCGARLPQYDLTYETYGQLNADASNAVLICHALSGNHHVAGHYDEEKSqGWWDQYIGPGKPIDT 85 678999*******************************************88877*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +r+fvvc+N+lG+c+Gs+gP+sinpetg+ +g++fP vt +D+v+ q+ l d Lg++ +aav+GgS+GG lcl|NCBI__GCF_000384235.1:WP_028485384.1 86 NRFFVVCSNNLGGCHGSSGPASINPETGDVFGPDFPIVTCKDWVNSQNVLRDYLGIDAWAAVIGGSMGG 154 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+++wa++yp+r+++++v+a+++++saq+iafnev+r+ai++Dpe+++G++ e + +P++GLalARml lcl|NCBI__GCF_000384235.1:WP_028485384.1 155 MQVMQWAMDYPDRLRHALVIAAAPKLSAQNIAFNEVARRAIMTDPEFHHGRFIEAGtTPKRGLALARML 223 ******************************************************999************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfver..FdAnsYllltkaldthdl 274 ++ltY+s++ + ++fgre ++ +l+++++ ef+vesylryqg+kf+++ FdAn+Yll+tkald++d lcl|NCBI__GCF_000384235.1:WP_028485384.1 224 GHLTYLSDDMMGSKFGRELREG-KLKYNFDVEFQVESYLRYQGEKFATKqnFDANTYLLMTKALDYFDP 291 *******************999.88999******************96444****************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekek 341 a++ ++sl++al++++a++lv++++sD++f++++++e++kal +++++ yaei+s++GHDaFll +++ lcl|NCBI__GCF_000384235.1:WP_028485384.1 292 AAEFDNSLAKALAQTTAKFLVISFTSDWRFSPKRSQEIVKALLDNDADvtYAEINSKHGHDAFLLPNAH 360 ******************************************99888888****************999 PP TIGR01392 342 veelirefl 350 +e + r+++ lcl|NCBI__GCF_000384235.1:WP_028485384.1 361 YEGVFRAYM 369 998887776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory