Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate WP_028485864.1 B076_RS0102205 pyrroline-5-carboxylate reductase
Query= SwissProt::P22008 (273 letters) >NCBI__GCF_000483485.1:WP_028485864.1 Length = 275 Score = 268 bits (685), Expect = 9e-77 Identities = 134/268 (50%), Positives = 187/268 (69%), Gaps = 1/268 (0%) Query: 6 IAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEAVADAD 65 + FIG GNMA SLIGGL A G P A I A+DP QR + F I E N +A+ AD Sbjct: 5 LCFIGGGNMAKSLIGGLIASGYPKANILATDPTLSQRNHLTETFGIACYEDNNQAIQQAD 64 Query: 66 VVVLSVKPQAMKAVCQALAPAL-KPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTPA 124 +V+L+VKPQ ++AVC+++ ++ K LI+S+AAGI + WLG + +VR MPNTPA Sbjct: 65 IVILAVKPQILQAVCKSIQDSIQKSNPLILSVAAGIRSNDINRWLGGNQAIVRTMPNTPA 124 Query: 125 LLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLLM 184 L++ GA+GLYAN QVS Q QA ++ A G+ +W+++E+Q+D VTA+SGSGPAY+FL M Sbjct: 125 LIQSGATGLYANPQVSQEQKNQAEHIMRAAGLTIWVNEESQLDVVTALSGSGPAYYFLFM 184 Query: 185 QAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKSF 244 +AM +++GL +TA LT+QTA GAA+M + S + AELR+ VTSPNGTTE AI +F Sbjct: 185 EAMEQTAQEMGLDAKTAHLLTMQTAFGAAKMVMESNLNCAELRQNVTSPNGTTEQAINTF 244 Query: 245 QANGFEALVEQALNAASQRSAELAEQLG 272 +A G ++++A+ AA R+ ELA +LG Sbjct: 245 EAEGLRDMIKKAMLAAQNRAVELANELG 272 Lambda K H 0.315 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 275 Length adjustment: 25 Effective length of query: 248 Effective length of database: 250 Effective search space: 62000 Effective search space used: 62000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_028485864.1 B076_RS0102205 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.14306.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-82 261.4 3.8 5.6e-82 261.3 3.8 1.0 1 lcl|NCBI__GCF_000483485.1:WP_028485864.1 B076_RS0102205 pyrroline-5-carbo Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000483485.1:WP_028485864.1 B076_RS0102205 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 261.3 3.8 5.6e-82 5.6e-82 2 263 .] 6 267 .. 5 267 .. 0.98 Alignments for each domain: == domain 1 score: 261.3 bits; conditional E-value: 5.6e-82 TIGR00112 2 aiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPq 70 +iG+Gnm+++l+ gl+++g + k++il +++ +++++l +++g++ ++d+++a+++ad+v+lavKPq lcl|NCBI__GCF_000483485.1:WP_028485864.1 6 CFIGGGNMAKSLIGGLIASGYP-KANILATDPTLSQRNHLTETFGIACYEDNNQAIQQADIVILAVKPQ 73 79*****************887.89******************************************** PP TIGR00112 71 dleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevsee 139 l++v++++++ ++ + l++S++AG++ ++++++l++++++vR mPNt+a +++g+t+++a+ +vs+e lcl|NCBI__GCF_000483485.1:WP_028485864.1 74 ILQAVCKSIQDSIQKSNPLILSVAAGIRSNDINRWLGGNQAIVRTMPNTPALIQSGATGLYANPQVSQE 142 ***********888899**************************************************** PP TIGR00112 140 qkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkG 207 qk+++e++++a G +++v+ e++ld vtalsGSgPA+ fl++ea+++++ ++GL++++a l++qt G lcl|NCBI__GCF_000483485.1:WP_028485864.1 143 QKNQAEHIMRAAGLTIWVNeESQLDVVTALSGSGPAYYFLFMEAMEQTAQEMGLDAKTAHLLTMQTAFG 211 *******************99************************************************ PP TIGR00112 208 aaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 aak+++es+ + a+L+++VtsP+GtT ++++++e++g+r+++ +a+ aa +r+ eL lcl|NCBI__GCF_000483485.1:WP_028485864.1 212 AAKMVMESNLNCAELRQNVTSPNGTTEQAINTFEAEGLRDMIKKAMLAAQNRAVEL 267 ****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.79 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory