Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_028486300.1 B076_RS0104740 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::A0A140N9B6 (406 letters) >NCBI__GCF_000483485.1:WP_028486300.1 Length = 426 Score = 133 bits (335), Expect = 9e-36 Identities = 108/361 (29%), Positives = 160/361 (44%), Gaps = 35/361 (9%) Query: 29 EGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLR-LA 87 +G+ L D+ K YID+ G LGHAHPE+ + + E+A G E + L Sbjct: 40 KGAYLVDEDDKTYIDYVGSWGPAILGHAHPEVIKTVQEKAEFGLSFGAPTKIETTMADLV 99 Query: 88 KKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFHGRT----- 142 LI + D V +SG EA A++LAR + + + IV F+ +HG + Sbjct: 100 CDLIPSM--DMVRMVSSGTEATMTAIRLARGY------TGRDKIVKFEGCYHGHSDSLLV 151 Query: 143 -----LFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALIDDSTCAVIVEPIQGEGG 197 T+ P A + H +++ A I D +IVEP+ G Sbjct: 152 KAGSGALTLGVPSSPGVPAALAEETLTLTHNDSDEVRKVFAEIGDQIACIIVEPVAGNMN 211 Query: 198 VVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG 257 +P FL+ LR++C+ A+LIFDEV G R G A Y VTPDL T K +GGG Sbjct: 212 CIPPEEGFLETLRQVCDESGAVLIFDEVMCGF-RVGLQGAQGRYNVTPDLTTFGKVIGGG 270 Query: 258 FPVGALLATEECAR-VMTVGT--HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDW 314 PVGA +E + + +G T GNP+A A K LELI+ P ++++ Sbjct: 271 MPVGAFGGKQEVMQHIAPLGPVYQAGTLSGNPIAMAAGLKTLELISAPGFFEELEKKTTR 330 Query: 315 FVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVR 374 V+ L + +G + G + D K IS+ A +A G++ R Sbjct: 331 LVKGLQAAADDNNIPFTTNQVGGMFGFFFSED-----KNISRFAQ-------VAKGDMER 378 Query: 375 F 375 F Sbjct: 379 F 379 Lambda K H 0.319 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 426 Length adjustment: 31 Effective length of query: 375 Effective length of database: 395 Effective search space: 148125 Effective search space used: 148125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory