Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_028486542.1 B076_RS0106155 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >NCBI__GCF_000483485.1:WP_028486542.1 Length = 377 Score = 459 bits (1182), Expect = e-134 Identities = 224/374 (59%), Positives = 277/374 (74%), Gaps = 1/374 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLF 63 S +ALA++LI SVTP D GCQ+L+ + L+ LGF IE+M F + +N WAR+G Q P Sbjct: 2 SETIALAQQLIQIDSVTPDDKGCQNLIADYLRPLGFNIEAMPFGEVSNLWARKGDQGPFI 61 Query: 64 VFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHPDH 123 VFAGHTDVVP GP S W PPF + ++GRG ADMK S+AC +VA +RFI + P H Sbjct: 62 VFAGHTDVVPTGPESAWSHPPFSAHIEGDMMYGRGTADMKSSIACFMVACKRFIGDFPQH 121 Query: 124 QGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGSI 183 GSIG+LITSDEEGP I+GTV+V+ETL ARNE D C+VGEPSS+ +GD +KNGRRGS+ Sbjct: 122 AGSIGYLITSDEEGPAIDGTVKVIETLEARNEKFDYCLVGEPSSSKKLGDSIKNGRRGSL 181 Query: 184 TGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGTG 243 +G L +KG QGH+AYP LA NP+H PAL +L QWD GN YFPPTSFQI N+ AGTG Sbjct: 182 SGHLTIKGIQGHIAYPELAENPIHTLAPALEQLVHLQWDHGNEYFPPTSFQISNINAGTG 241 Query: 244 ASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDT-GEL 302 A+NVIPG +V FNFRFSTE T E +K VH+VLD H L+YD+ W+LSG PF+T GEL Sbjct: 242 ATNVIPGSVEVLFNFRFSTEHTPETLKEGVHAVLDHHNLNYDLDWSLSGLPFITPAQGEL 301 Query: 303 LAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLE 362 + AV A + V P L T GGTSDGRFIA GAQV+ELGP+NATIH+++E V I+DLE Sbjct: 302 IQAVTQATKTVMGYEPELSTGGGTSDGRFIAPTGAQVIELGPLNATIHQIDERVSISDLE 361 Query: 363 KLTDMYQKTLNHLL 376 LT++Y +TL +LL Sbjct: 362 HLTEIYYQTLVNLL 375 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 377 Length adjustment: 30 Effective length of query: 347 Effective length of database: 347 Effective search space: 120409 Effective search space used: 120409 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_028486542.1 B076_RS0106155 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.29602.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-171 553.7 0.0 1.1e-170 553.5 0.0 1.0 1 lcl|NCBI__GCF_000483485.1:WP_028486542.1 B076_RS0106155 succinyl-diaminop Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000483485.1:WP_028486542.1 B076_RS0106155 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 553.5 0.0 1.1e-170 1.1e-170 3 370 .] 6 374 .. 4 374 .. 0.99 Alignments for each domain: == domain 1 score: 553.5 bits; conditional E-value: 1.1e-170 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGe 71 +la++Li++ svtP+d+g+q+lia+ L+ lgf+ie + f+++ nlwa++g + p +vfaGhtDvvP+G+ lcl|NCBI__GCF_000483485.1:WP_028486542.1 6 ALAQQLIQIDSVTPDDKGCQNLIADYLRPLGFNIEAMPFGEVSNLWARKGDQGPFIVFAGHTDVVPTGP 74 799****************************************************************** PP TIGR01246 72 lekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkk 140 +++Ws +pf+++++ ++ygrG+aDmk+s+a+f+va++rf+ ++++h Gs++ litsDeeg aidGt+k lcl|NCBI__GCF_000483485.1:WP_028486542.1 75 ESAWSHPPFSAHIEGDMMYGRGTADMKSSIACFMVACKRFIGDFPQHAGSIGYLITSDEEGPAIDGTVK 143 ********************************************************************* PP TIGR01246 141 vvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlk 209 v+etl++r+e+ dy++vgePss+kklGD+ik+GrrGs++g+l+ikGiqGh+aYP++aenP+h+++p+l+ lcl|NCBI__GCF_000483485.1:WP_028486542.1 144 VIETLEARNEKFDYCLVGEPSSSKKLGDSIKNGRRGSLSGHLTIKGIQGHIAYPELAENPIHTLAPALE 212 ********************************************************************* PP TIGR01246 210 eliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkld 278 +l++ ++D+Gne+fpp+s+qi+ni+agtga+nviPg+++v fn+rfs+e++ e+lk+ v+++ld+h+l+ lcl|NCBI__GCF_000483485.1:WP_028486542.1 213 QLVHLQWDHGNEYFPPTSFQISNINAGTGATNVIPGSVEVLFNFRFSTEHTPETLKEGVHAVLDHHNLN 281 ********************************************************************* PP TIGR01246 279 Yelewklsgepfltk.egklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihk 346 Y+l+w+lsg pf+t +g+li++v++a + v++ +pelst+GGtsD+rfia ga+v+elG++n+tih+ lcl|NCBI__GCF_000483485.1:WP_028486542.1 282 YDLDWSLSGLPFITPaQGELIQAVTQATKTVMGYEPELSTGGGTSDGRFIAPTGAQVIELGPLNATIHQ 350 **************999**************************************************** PP TIGR01246 347 vneavkiedleklsevyeklleel 370 ++e+v+i+dle+l+e+y+++l +l lcl|NCBI__GCF_000483485.1:WP_028486542.1 351 IDERVSISDLEHLTEIYYQTLVNL 374 ********************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.56 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory