Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_028487133.1 B076_RS0109690 aspartate aminotransferase family protein
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000483485.1:WP_028487133.1 Length = 390 Score = 242 bits (617), Expect = 2e-68 Identities = 141/372 (37%), Positives = 204/372 (54%), Gaps = 11/372 (2%) Query: 24 YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 83 Y + + +G GA + D G Y+D V G V +LGH +P V EA+ Q+ L+ Sbjct: 9 YARLPVTFEKGAGAILQDTNGKSYLDAVSGIAVCSLGHAHPAVAEAICEQSHQLIHTSNL 68 Query: 84 LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKF-----VAAMR 138 + + LT + ++R F NSG EANE ALK A+ +K + Sbjct: 69 YNVANQQKLSDRLTEL--SGMDRAFFCNSGAEANETALKIAKKFGHQKGIDNPAVIVMEN 126 Query: 139 GFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEET-AAVILEPVQGE 197 F GRTM +LS T K E F PLVE +PY++VEA+K+ D A+++EPVQGE Sbjct: 127 SFHGRTMATLSATGNAKVHEGFTPLVEGFVRVPYDNVEAVKQHSDNANIVAILVEPVQGE 186 Query: 198 GGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALG 257 GGV +L + I ++ LL+LDEIQTG+GRTGK FAF+H + PD+LTLAKALG Sbjct: 187 GGVHVPKAGYLTELKAICEQNDWLLMLDEIQTGIGRTGKWFAFQHESVTPDVLTLAKALG 246 Query: 258 GGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWF 317 GVP+G + + + A + G HGTTFGGNPLA AAG+A + +E A+ G Sbjct: 247 NGVPIGCCLAKGKAADVLVPGNHGTTFGGNPLACAAGLAVLNIMEMHNYIPHVAKKGQTL 306 Query: 318 MEKLR--AIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPP 375 +E+ R + E+RG G M+G++L + + + ++ + G TV R LPP Sbjct: 307 LERFREELKDQSSVIEIRGKGYMIGIQLDRPCGELVTKALENGLLINVTRGDTV-RLLPP 365 Query: 376 LVIEKEDLERVV 387 V++ E E+++ Sbjct: 366 FVMDTEQKEQLI 377 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 390 Length adjustment: 31 Effective length of query: 364 Effective length of database: 359 Effective search space: 130676 Effective search space used: 130676 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory