Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_028487477.1 Q394_RS0100065 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >NCBI__GCF_000621325.1:WP_028487477.1 Length = 275 Score = 296 bits (758), Expect = 3e-85 Identities = 161/275 (58%), Positives = 191/275 (69%), Gaps = 4/275 (1%) Query: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGG-NV 59 +D Y VFGNPI HSKSP IH LF EQTG +EY + + +EF+ F G G NV Sbjct: 2 VDNYAVFGNPIAHSKSPRIHTLFGEQTGGAVEYGAICSEPEEFAQDVMMFLVAGGKGCNV 61 Query: 60 TVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAG 119 TVP+K+EA+ L D L+ A RA AVNTL+ DGT+ G NTDG G+VRDL N G+ L G Sbjct: 62 TVPYKQEAWELADELSDYAARAKAVNTLAFSEDGTMVGYNTDGIGIVRDLQQNHGIALQG 121 Query: 120 KRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQE 179 KRIL+LGAGGAVRGVL+P+L +P SL IANRT KA +LA++F E G V GFA + Sbjct: 122 KRILLLGAGGAVRGVLQPLLEAQPASLFIANRTASKALELAQDFAEFGKVSGGGFADIDG 181 Query: 180 PVDVIINATSASLAGELPPI-ADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDG 238 D+IIN T+ASL GELPP+ A L G T YDMMY +PT F W GAA+ LDG Sbjct: 182 QFDLIINGTAASLQGELPPLPAGCLAADGCT--YDMMYSAKPTAFVAWGRAQGAAQSLDG 239 Query: 239 LGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLAR 273 LGML EQAAEAFFIWRGVRP TAPVLA+LR +L+R Sbjct: 240 LGMLVEQAAEAFFIWRGVRPSTAPVLAQLREELSR 274 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 275 Length adjustment: 25 Effective length of query: 249 Effective length of database: 250 Effective search space: 62250 Effective search space used: 62250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_028487477.1 Q394_RS0100065 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.26791.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-82 261.6 0.0 3.7e-82 261.5 0.0 1.0 1 lcl|NCBI__GCF_000621325.1:WP_028487477.1 Q394_RS0100065 shikimate dehydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000621325.1:WP_028487477.1 Q394_RS0100065 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 261.5 0.0 3.7e-82 3.7e-82 2 269 .. 4 272 .. 3 273 .. 0.97 Alignments for each domain: == domain 1 score: 261.5 bits; conditional E-value: 3.7e-82 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 ++v+Gnpi+hSksp ih + +q+g ++eY a+ e+ee+ + + + +g kG+nvTvP+K+e+ el lcl|NCBI__GCF_000621325.1:WP_028487477.1 4 NYAVFGNPIAHSKSPRIHTLFGEQTGGAVEYGAICSEPEEFAQDVMMFLVAGGKGCNVTVPYKQEAWEL 72 59******************************************************************* PP TIGR00507 71 lDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLl 137 +De+++ a+ ++avNTl edg +vgynTDgiG+v +L++ ++kr+l++GAGGa ++v+ +Ll lcl|NCBI__GCF_000621325.1:WP_028487477.1 73 ADELSDYAARAKAVNTLAfSEDGTMVGYNTDGIGIVRDLQQnHGIALQGKRILLLGAGGAVRGVLQPLL 141 ******************999********************7555556********************* PP TIGR00507 138 ka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellk 205 +a + ++ iaNRt +ka ela+ ++e+g++ ++++ ++dliin t+a+l+ge+ ++++a+ l+ lcl|NCBI__GCF_000621325.1:WP_028487477.1 142 EAqPASLFIANRTASKALELAQDFAEFGKVSGGGFADIDG-QFDLIINGTAASLQGEL--PPLPAGCLA 207 986899****************************999987.6****************..********* PP TIGR00507 206 egklvvDlvynpletpllkeakkkg.tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 ++ + +D++y + t+++++ + +g ++ +dGlgMlv+Qaa +F +w+gv p v +l+e+l lcl|NCBI__GCF_000621325.1:WP_028487477.1 208 ADGCTYDMMYSAKPTAFVAWGRAQGaAQSLDGLGMLVEQAAEAFFIWRGVRPSTAPVLAQLREEL 272 *************************999********************************99988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (275 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.34 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory