Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_028489948.1 Q394_RS0114840 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_000621325.1:WP_028489948.1 Length = 424 Score = 366 bits (940), Expect = e-106 Identities = 195/429 (45%), Positives = 276/429 (64%), Gaps = 13/429 (3%) Query: 5 VNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQI 64 VN LR ASPYI HR++TFV+ PGE VE P F ++ D+ + +LG+R+V+VHG+R QI Sbjct: 8 VNLLREASPYIQQHRNKTFVIAFPGEVVEQPTFSRLIQDIATVSALGSRIVIVHGTRAQI 67 Query: 65 EARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRVA 124 RLAA G H ++RVT + V +AVG LRI IE+ LS + ++ A + V+ Sbjct: 68 NQRLAAAGRVAHIHHNIRVTHPDDIPLVEEAVGYLRIKIESLLSHALNQPGLENASIGVS 127 Query: 125 GGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLAC 184 GN +TA+P+G+++GVDY HTG++RRI + I + LD +IVL+SP+GYSP+GE +N+ Sbjct: 128 SGNYITAQPLGIIDGVDYGHTGKIRRIAHRFIQQQLDSHNIVLMSPIGYSPSGETYNIDY 187 Query: 185 EDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGNSYQAELLDAA 244 E VA+ A L A+K+I + D +L E+ Q+ A ++ + L Sbjct: 188 EHVALSTAKALNADKIIF------ISDNDAQLPHEITAGQIDA------DANASPFLKKI 235 Query: 245 AQACRAG-VKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIELI 303 A+ G +R H+++ DGALL E++TR G G+L+A + FEQ+R A +ED+ G+++LI Sbjct: 236 ARILLDGDSERVHLLNAATDGALLLEVYTRDGVGSLIAAQHFEQMRAATVEDISGILDLI 295 Query: 304 RPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPEYR 363 RPLE +G L++RSRE LE EI F + R+ IIAC ALY + + ELACLAV+ +YR Sbjct: 296 RPLESKGTLIKRSREQLELEISNFHVTVRDQKIIACVALYHTDNPDIAELACLAVHTDYR 355 Query: 364 HGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNFQR 423 G RGD+LL I + A+ G L VLTT+T WFRERGF SV+ LP + SLYN+QR Sbjct: 356 SGNRGDKLLRHIAQLAKTQGTARLLVLTTQTTDWFRERGFIKGSVDELPPNKKSLYNYQR 415 Query: 424 NSQVFEKSL 432 NSQV K+L Sbjct: 416 NSQVLFKTL 424 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 424 Length adjustment: 32 Effective length of query: 400 Effective length of database: 392 Effective search space: 156800 Effective search space used: 156800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_028489948.1 Q394_RS0114840 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.12834.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-146 472.8 0.5 7e-146 472.4 0.5 1.1 1 lcl|NCBI__GCF_000621325.1:WP_028489948.1 Q394_RS0114840 amino-acid N-acet Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000621325.1:WP_028489948.1 Q394_RS0114840 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.4 0.5 7e-146 7e-146 2 429 .] 8 424 .] 7 424 .] 0.97 Alignments for each domain: == domain 1 score: 472.4 bits; conditional E-value: 7e-146 TIGR01890 2 vkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgr 70 v+ lrea+Pyi++hr+kt+v++++ge+ve++++++l++dia +++lG r+v+vhG+r qi++rla+ gr lcl|NCBI__GCF_000621325.1:WP_028489948.1 8 VNLLREASPYIQQHRNKTFVIAFPGEVVEQPTFSRLIQDIATVSALGSRIVIVHGTRAQINQRLAAAGR 76 899****************************************************************** PP TIGR01890 71 tthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdy 139 +h ++ +rvt + lv+ea+G lr +ie+ ls++l++ + + + v sGn++ta+P+G+++Gvdy lcl|NCBI__GCF_000621325.1:WP_028489948.1 77 VAHIHHNIRVTHPDDIPLVEEAVGYLRIKIESLLSHALNQPGLENASIGVSSGNYITAQPLGIIDGVDY 145 ********************************************************************* PP TIGR01890 140 ehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGild 208 htG++r+i + i+++ld+ +ivl+sP+g+s++Ge++n++ e+va s+a +l+adk+i++ +d lcl|NCBI__GCF_000621325.1:WP_028489948.1 146 GHTGKIRRIAHRFIQQQLDSHNIVLMSPIGYSPSGETYNIDYEHVALSTAKALNADKIIFI------SD 208 ***********************************************************96......67 PP TIGR01890 209 adGklvaelsaqeveslverleeettarllsaavkal.rgGvarshlvsyaedGallqelftrdGiGtl 276 +d +l +e++a ++++ ++ + +l+++++ l g +r+hl++ a+dGall+e++trdG+G l lcl|NCBI__GCF_000621325.1:WP_028489948.1 209 NDAQLPHEITAGQIDADAN------ASPFLKKIARILlDGDSERVHLLNAATDGALLLEVYTRDGVGSL 271 8899999999888876543......357899988875267789************************** PP TIGR01890 277 vskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyaee 345 ++ +++e++r at++d++gil+lirPle +G+l++rsre+le ei++f v +d ii+c aly + lcl|NCBI__GCF_000621325.1:WP_028489948.1 272 IAAQHFEQMRAATVEDISGILDLIRPLESKGTLIKRSREQLELEISNFHVTVRDQKIIACVALYHTDNP 340 ********************************************************************* PP TIGR01890 346 evgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearrk 414 +++elaclav+ ++r g+rG++ll+hi + a++ G rl+vltt+t++WfrerGf + svdelP ++++ lcl|NCBI__GCF_000621325.1:WP_028489948.1 341 DIAELACLAVHTDYRSGNRGDKLLRHIAQLAKTQGTARLLVLTTQTTDWFRERGFIKGSVDELPPNKKS 409 ********************************************************************* PP TIGR01890 415 lynyqrrskilvkkl 429 lynyqr+s++l k l lcl|NCBI__GCF_000621325.1:WP_028489948.1 410 LYNYQRNSQVLFKTL 424 ***********9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (424 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory