Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_028490259.1 Q394_RS0116805 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000621325.1:WP_028490259.1 Length = 346 Score = 431 bits (1109), Expect = e-125 Identities = 212/343 (61%), Positives = 255/343 (74%) Query: 46 KVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEPDV 105 K+GIVG TGYTGVELLR+L HP+V ++C+TSR AG V M+PNLRG+ DLAF+ P Sbjct: 4 KIGIVGATGYTGVELLRLLVSHPDVEITCVTSREHAGSRVDAMFPNLRGYLDLAFTAPSD 63 Query: 106 NVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESPEW 165 L ACDLVFFATP+GVAM+ L+ AG +V+DL+ADFR+KD+ +W WYGM H SP Sbjct: 64 EALSACDLVFFATPNGVAMKSTQTLLDAGTKVIDLAADFRIKDIAIWEKWYGMQHASPNL 123 Query: 166 AEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSGASG 225 E+AVYGLPE+ R+ IR A+LVANPGCYPTAV LG LPL+E GL+D + +IAD KSG SG Sbjct: 124 VEEAVYGLPELNREHIRQARLVANPGCYPTAVTLGLLPLVENGLIDLEGIIADTKSGVSG 183 Query: 226 AGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIRGIE 285 AGR+ ++ L E G++FKAY +GHRH PEI Q L A + FVPHL+PMIRGI Sbjct: 184 AGRKAEVHALLAEAGDNFKAYAVAGHRHQPEIAQTLSTVAQISIDPVFVPHLLPMIRGIH 243 Query: 286 ATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQEQS 345 ATLYA L A LQ L+ R+ +EPFVDVMP GSHPETRSVRGAN CRMA+HR + Sbjct: 244 ATLYAMLSVEAAQADLQQLYTTRYANEPFVDVMPAGSHPETRSVRGANVCRMAIHRPGNA 303 Query: 346 NIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 V+V SVIDNLVKGAAGQAVQNMN+M GL E + L+ P LLP Sbjct: 304 RRVVVLSVIDNLVKGAAGQAVQNMNLMLGLSEHIALQQPGLLP 346 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 346 Length adjustment: 30 Effective length of query: 358 Effective length of database: 316 Effective search space: 113128 Effective search space used: 113128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_028490259.1 Q394_RS0116805 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.27239.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-136 441.6 0.0 1.2e-136 441.4 0.0 1.0 1 lcl|NCBI__GCF_000621325.1:WP_028490259.1 Q394_RS0116805 N-acetyl-gamma-gl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000621325.1:WP_028490259.1 Q394_RS0116805 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.4 0.0 1.2e-136 1.2e-136 2 345 .] 4 346 .] 3 346 .] 0.98 Alignments for each domain: == domain 1 score: 441.4 bits; conditional E-value: 1.2e-136 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssre.agkklsevhphlkglvdlkleeleeeeileead 69 k++ivGa+GYtG+eLlrll +Hp+ve+t +v+sre ag+++++++p+l+g +dl +++ ++e +l+++d lcl|NCBI__GCF_000621325.1:WP_028490259.1 4 KIGIVGATGYTGVELLRLLVSHPDVEIT-CVTSREhAGSRVDAMFPNLRGYLDLAFTAPSDE-ALSACD 70 79**************************.7777777*********************98887.567*** PP TIGR01850 70 vvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreei 138 +vf+A+p+gv+++ ++ll++g+kvidl+adfR+kd +++ekwYg++h++++l+eeavYGlpElnre+i lcl|NCBI__GCF_000621325.1:WP_028490259.1 71 LVFFATPNGVAMKSTQTLLDAGTKVIDLAADFRIKDIAIWEKWYGMQHASPNLVEEAVYGLPELNREHI 139 ********************************************************************* PP TIGR01850 139 kkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvtk 207 ++a+l+anPGCy+Ta++L+l Pl++++li+ + ii d ksGvSgAGrka+ + l+ae+ +n+k+Y+v++ lcl|NCBI__GCF_000621325.1:WP_028490259.1 140 RQARLVANPGCYPTAVTLGLLPLVENGLIDLEGIIADTKSGVSGAGRKAEVHALLAEAGDNFKAYAVAG 208 ********************************************************************* PP TIGR01850 208 HrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlk 276 HrH+pEi+q+ls++a+ ++ f+phl+pm+rGi+at+ya l+ e +++l++ly+++Y++epfv+v++ lcl|NCBI__GCF_000621325.1:WP_028490259.1 209 HRHQPEIAQTLSTVAQISIDPVFVPHLLPMIRGIHATLYAMLSVEAAQADLQQLYTTRYANEPFVDVMP 277 ************9998899999*********************************************** PP TIGR01850 277 egelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +g+ P+t++v+g n+++++++ +++rvvv+s+iDNLvKGaagqAvqn+Nlmlg++e+ +L++ +llp lcl|NCBI__GCF_000621325.1:WP_028490259.1 278 AGSHPETRSVRGANVCRMAIHRPGNARRVVVLSVIDNLVKGAAGQAVQNMNLMLGLSEHIALQQPGLLP 346 ****************************************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory