Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.78; Transaminase A (uncharacterized)
to candidate WP_028583175.1 G494_RS0101930 pyridoxal phosphate-dependent aminotransferase
Query= curated2:O67781 (394 letters) >NCBI__GCF_000429965.1:WP_028583175.1 Length = 394 Score = 200 bits (508), Expect = 7e-56 Identities = 126/386 (32%), Positives = 201/386 (52%), Gaps = 18/386 (4%) Query: 8 RVSHLKPSPTLTITAKAKELRAKGVDVIGFGAGEPDFDTPDFIKEAC--IRALREGKTKY 65 R+ + PS T + +A + D + G G P F P+ + A + A + Y Sbjct: 13 RIQAVAPSATKLMAQRAAAID----DTVSLGQGVPGFAPPEEVLAAVQEVIATNGASSNY 68 Query: 66 APSAGIPELREAIAEKLLKENKVEYKPSE-IVVSAGAKMVLFLIFMAILDEGDEVLLPSP 124 + G+PELR +A+ L E +VE P E + ++ G L + ++DEGDEVLLPSP Sbjct: 69 SLQNGLPELRRRLAQHLFLEKEVELDPDEELCITVGGMEGLLAAILTVVDEGDEVLLPSP 128 Query: 125 YWVTYPEQIRFFGGVPVEVPLKKEKGFQLSLEDVKEKVTERTKAIVINSPNNPTGAVYEE 184 + +Y EQI GG PV VPL + ++L ++ +T T+AI++ +P NPTG VY + Sbjct: 129 TYASYSEQILLAGGRPVYVPLGPK--WELDFTRLEAALTPGTRAILLCNPGNPTGNVYTD 186 Query: 185 EELKKIAEFCVERGIFIISDECYEYFVYGDAKFVSPASFSDEVKNITFTVNAFSKSYSMT 244 +E++ I VERG+ +I DE Y+Y +YG + +P + + ++ ++ + SK Y +T Sbjct: 187 QEIQAICRLAVERGLVVIIDEAYDYMIYGGKQAANPLAMA-PYRDHVISIGSLSKKYCLT 245 Query: 245 GWRIGYVACPEEYAKVIASLNSQSVSNVTTFAQYGALEALKNPKSKDFVNEMRNAFERRR 304 GWR+G+VA + + I ++ + T +QY AL AL+ +V E +RRR Sbjct: 246 GWRVGWVAARPHWMEHIMKVHDAATICAPTPSQYAALAALET--EPQWVEECCRRLDRRR 303 Query: 305 DTAVEELSKI-PGMDVVKPEGAFYIFPDFSAYAEKLGGDVKLSEFLLEKAKVAVVPGSAF 363 L ++ P V P GAFYI + ++E+ V + LLE+ V VPG +F Sbjct: 304 QLCCRRLDELHPYFSYVPPRGAFYIMARY-LWSEEASDQVAIQ--LLEETGVITVPGGSF 360 Query: 364 --GAPGFLRLSYALSEERLVEGIRRI 387 G G LRLS+ +E + R+ Sbjct: 361 GLGGEGHLRLSFGGTEATINTAFDRL 386 Lambda K H 0.317 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory