Align Aromatic-amino-acid aminotransferase 2; ARAT-II; AROAT; EC 2.6.1.57 (characterized)
to candidate WP_028583175.1 G494_RS0101930 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::H3ZPU1 (389 letters) >NCBI__GCF_000429965.1:WP_028583175.1 Length = 394 Score = 226 bits (577), Expect = 7e-64 Identities = 133/381 (34%), Positives = 213/381 (55%), Gaps = 10/381 (2%) Query: 4 SDRLEMVNPSEIRKLFDLAQGIEGIISLGIGEPDFDTPEHIKEYAKE--ALDKGLTHYSP 61 S R++ V PS + + A I+ +SLG G P F PE + +E A + ++YS Sbjct: 11 SRRIQAVAPSATKLMAQRAAAIDDTVSLGQGVPGFAPPEEVLAAVQEVIATNGASSNYSL 70 Query: 62 NIGILELREAVAEKFKKHNGIDADPKTQIMITVGTNQQILMGLATFLKDNEEVLIPSPMF 121 G+ ELR +A+ ++ DP ++ ITVG + +L + T + + +EVL+PSP + Sbjct: 71 QNGLPELRRRLAQHLFLEKEVELDPDEELCITVGGMEGLLAAILTVVDEGDEVLLPSPTY 130 Query: 122 VSYAPAVILAGGKPVEVPTYEENEFRLSVDELEKYVTPKTRALIINTPNNPTGAVLTKKD 181 SY+ ++LAGG+PV VP + E L LE +TP TRA+++ P NPTG V T ++ Sbjct: 131 ASYSEQILLAGGRPVYVPLGPKWE--LDFTRLEAALTPGTRAILLCNPGNPTGNVYTDQE 188 Query: 182 LEEIADFAVEHDLMILSDEVYEYFVYDGVKNYSIASLDGMFERTITMNGFSKTFAMTGWR 241 ++ I AVE L+++ DE Y+Y +Y G + + ++ + I++ SK + +TGWR Sbjct: 189 IQAICRLAVERGLVVIIDEAYDYMIYGGKQAANPLAMAPYRDHVISIGSLSKKYCLTGWR 248 Query: 242 LGFLAA-PEWVVEKMVRFQMYNATCPVTFIQYAAAKALRDERSWQAVEEMRREYERRRNL 300 +G++AA P W +E +++ C T QYAA AL E W VEE R +RRR L Sbjct: 249 VGWVAARPHW-MEHIMKVHDAATICAPTPSQYAALAALETEPQW--VEECCRRLDRRRQL 305 Query: 301 VWKRLNEMG--LPTVKPKGAFYIFPRIKDTGLSSKEFSELMIKEAKVVVVPGSAFGQAGE 358 +RL+E+ V P+GAFYI R + +S + + +++E V+ VPG +FG GE Sbjct: 306 CCRRLDELHPYFSYVPPRGAFYIMARYLWSEEASDQVAIQLLEETGVITVPGGSFGLGGE 365 Query: 359 GYVRISYATAYEKLEEAMDRM 379 G++R+S+ + A DR+ Sbjct: 366 GHLRLSFGGTEATINTAFDRL 386 Lambda K H 0.318 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 394 Length adjustment: 31 Effective length of query: 358 Effective length of database: 363 Effective search space: 129954 Effective search space used: 129954 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory