Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate WP_028584701.1 G494_RS0111760 carbamoyl-phosphate synthase small subunit
Query= SwissProt::Q9LVW7 (430 letters) >NCBI__GCF_000429965.1:WP_028584701.1 Length = 371 Score = 365 bits (937), Expect = e-105 Identities = 186/371 (50%), Positives = 242/371 (65%), Gaps = 3/371 (0%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A + LEDG++ KSF PG + E+VFNTS++GYQE+LTDPSY GQ V MT P IGN G Sbjct: 3 ALIGLEDGTVISGKSFTGPGEVMGEMVFNTSMSGYQEVLTDPSYTGQLVTMTYPLIGNYG 62 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 VN +D ES ++R SN R T TL D L ++G+ DTR +TR LR+ Sbjct: 63 VNEEDMESAGVHPRAFLMREYQALPSNHRATGTLVDLLQRHQVLGIEGFDTRMLTRLLRK 122 Query: 178 DGSLIGVLSTEQSKTDDELLQMSRSW-DIVGIDLISDVSCKSPYEWVDKTNAEWDFNTNS 236 G++ +STE D L+ +RSW +VG D+++ VSC PY W + E S Sbjct: 123 SGAMKAAISTEDLD-GDSLVAKARSWAGLVGRDMVARVSCARPYLWTAEGPREAAAFPAS 181 Query: 237 RDGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGPGDPS 296 +++V+A DFG K N LR LS YGCQ+ VVP+T AAE L + PDGI SNGPGDP Sbjct: 182 GSA-AFRVVALDFGAKYNQLRLLSQYGCQVMVVPATTGAAEILALQPDGIFLSNGPGDPD 240 Query: 297 AVPYAVETVKELLGKVPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRTGQVEI 356 V VE V++LLGK P++GIC+GHQ+L A GG T+K+KFGH GGN PV++ TG+VEI Sbjct: 241 GVQGVVENVRQLLGKKPIFGICLGHQMLALAYGGSTYKLKFGHRGGNQPVKDLTTGKVEI 300 Query: 357 SAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPHDSDNAF 416 +AQNH + VDP SLP VEVTH+NLND S G+ + S+QYHPE +PGPHD++ F Sbjct: 301 TAQNHGFCVDPESLPPEVEVTHINLNDNSLEGMRHRDYPAFSVQYHPEYAPGPHDAEYLF 360 Query: 417 REFIELMKRSK 427 FIELM++S+ Sbjct: 361 SRFIELMQQSR 371 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 371 Length adjustment: 31 Effective length of query: 399 Effective length of database: 340 Effective search space: 135660 Effective search space used: 135660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_028584701.1 G494_RS0111760 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.26094.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-151 489.2 0.0 4.1e-151 489.0 0.0 1.0 1 lcl|NCBI__GCF_000429965.1:WP_028584701.1 G494_RS0111760 carbamoyl-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028584701.1 G494_RS0111760 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 489.0 0.0 4.1e-151 4.1e-151 2 360 .. 4 368 .. 3 369 .. 0.97 Alignments for each domain: == domain 1 score: 489.0 bits; conditional E-value: 4.1e-151 TIGR01368 2 tlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskk 70 + ledGtv++gksf ++ev+Ge+vFnTsm+GYqE+ltDpsY+gq+v++typlignygvneed+es lcl|NCBI__GCF_000429965.1:WP_028584701.1 4 LIGLEDGTVISGKSFTGPGEVMGEMVFNTSMSGYQEVLTDPSYTGQLVTMTYPLIGNYGVNEEDMESAG 72 5779***************************************************************** PP TIGR01368 71 ikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelv 139 ++ ++++++e+++ +sn+ra+ +L + l+++++ +ieg DTR+l++ lR++g+mka+iste+ + ++lv lcl|NCBI__GCF_000429965.1:WP_028584701.1 73 VHPRAFLMREYQALPSNHRATGTLVDLLQRHQVLGIEGFDTRMLTRLLRKSGAMKAAISTEDLDGDSLV 141 ********************************************************************* PP TIGR01368 140 ekakespkvkevnlvkevstkeayeleq...k....akkegkk.lrvvvidlGvKenilreLvkrgvev 200 +ka++ + + + ++v++vs++++y +++ + ++g+ rvv++d+G K n+lr L+++g++v lcl|NCBI__GCF_000429965.1:WP_028584701.1 142 AKARSWAGLVGRDMVARVSCARPYLWTAegpReaaaFPASGSAaFRVVALDFGAKYNQLRLLSQYGCQV 210 ***************************955515555444555559************************ PP TIGR01368 201 tvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyk 269 +vvpa+t a+ei +l+pdgi+lsnGPGdP+ v+ ++e+v++ll+ k+PifGIclGhq+lala+g++tyk lcl|NCBI__GCF_000429965.1:WP_028584701.1 211 MVVPATTGAAEILALQPDGIFLSNGPGDPDGVQGVVENVRQLLG-KKPIFGICLGHQMLALAYGGSTYK 278 ********************************************.************************ PP TIGR01368 270 lkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyH 338 lkfGhrG+N+pvkdl+tg+veit+qNHg+ vd+esl+ e +evth nlnD+++eg++h+++p+fsvQyH lcl|NCBI__GCF_000429965.1:WP_028584701.1 279 LKFGHRGGNQPVKDLTTGKVEITAQNHGFCVDPESLPPE-VEVTHINLNDNSLEGMRHRDYPAFSVQYH 346 ***********************************9876.***************************** PP TIGR01368 339 PeaspGphdteylFdefvelik 360 Pe +pGphd+eylF++f+el++ lcl|NCBI__GCF_000429965.1:WP_028584701.1 347 PEYAPGPHDAEYLFSRFIELMQ 368 ********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory