Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate WP_028742672.1 RL_RS24095 glutamate 5-kinase
Query= reanno::Korea:Ga0059261_3512 (367 letters) >NCBI__GCF_000009265.1:WP_028742672.1 Length = 389 Score = 316 bits (810), Expect = 6e-91 Identities = 180/362 (49%), Positives = 240/362 (66%), Gaps = 8/362 (2%) Query: 11 RLVVKIGSALLVDPEGAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIALGARRLKLAKG 70 R+V+KIGSALLVD + +++ WL+ + ADI+ G + VVSSGAIALG L L G Sbjct: 12 RIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIALGRSVLDLPSG 71 Query: 71 GRASLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRYLNAAATLGRL 130 LE++QAAAA GQIAL++ W+E L+ + + A Q+L+TL D E+RRRYLNA AT+ +L Sbjct: 72 A-LKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRYLNARATINQL 130 Query: 131 LSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGLYDRNPAL-PG 189 L +G VP+INEND+VAT+EIR+GDNDRLAARVA A ++LLSDIDGLY P L P Sbjct: 131 LKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGLYTAPPHLDPN 190 Query: 190 AVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIANGRVDRPLS 249 A + + I +E MA G+AS + GGM +KI+A +IA ++G ++ IA+G+ + PLS Sbjct: 191 ATFLETIAEITPEIEAMAG-GAASELSRGGMRTKIDAGKIATASGCAMIIASGKTENPLS 249 Query: 250 A---DARHTVFLPE-KRTRARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLAIGATAIR 305 A AR + F P ARK W+AG+L G + VD GA AL G+SLL G ++ Sbjct: 250 AIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDGAVTALGAGKSLLPAGVRSVS 309 Query: 306 GMFFRGDLVTIEGPNG-PIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRSTLVHRNHM 364 G+F RGD V I GP G IARGL YDA DA+ I G +S + ILGY R+ +VHR+ M Sbjct: 310 GLFSRGDTVAIIGPAGREIARGLVSYDADDARRIAGRKSAEIETILGYPGRAAMVHRDDM 369 Query: 365 AL 366 + Sbjct: 370 VM 371 Lambda K H 0.319 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 389 Length adjustment: 30 Effective length of query: 337 Effective length of database: 359 Effective search space: 120983 Effective search space used: 120983 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_028742672.1 RL_RS24095 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.1502.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-123 396.8 0.1 5.7e-123 396.6 0.1 1.0 1 lcl|NCBI__GCF_000009265.1:WP_028742672.1 RL_RS24095 glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000009265.1:WP_028742672.1 RL_RS24095 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.6 0.1 5.7e-123 5.7e-123 1 363 [] 11 371 .. 11 371 .. 0.98 Alignments for each domain: == domain 1 score: 396.6 bits; conditional E-value: 5.7e-123 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQ 69 +riV+K+Gs++L++ + lk++ l +++++++ lk++G +v++vsSGa+a G + L+lp+ kl+e Q lcl|NCBI__GCF_000009265.1:WP_028742672.1 11 RRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIALGRSVLDLPSGALKLEESQ 79 59******************************************************************* PP TIGR01027 70 alaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvave 138 a+aaVGQ +L +++++++s++++ +QiLLt d ++r+rylNar+t+++ll++g+vpi+NENDtva++ lcl|NCBI__GCF_000009265.1:WP_028742672.1 80 AAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRYLNARATINQLLKIGAVPIINENDTVATS 148 ********************************************************************* PP TIGR01027 139 eikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGT 207 ei+ GDND+L+a va++ +AdlL+ll+d+dgLy+a p+ +p+A+++e++ ei+ e++a+ag+++s++ lcl|NCBI__GCF_000009265.1:WP_028742672.1 149 EIRYGDNDRLAARVATMTGADLLILLSDIDGLYTAPPHLDPNATFLETIAEITPEIEAMAGGAASELSR 217 ********************************************************************* PP TIGR01027 208 GGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkii 276 GGmrtK+ a ++A+++g +iiasg++ e+ ++++e+ a + f+++ + + +rk+wi+ +++++G++ lcl|NCBI__GCF_000009265.1:WP_028742672.1 218 GGMRTKIDAGKIATASGCAMIIASGKT-ENPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELH 285 *************************98.5556677888889**************************** PP TIGR01027 277 vdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglkseeied 345 vd+ga++al + gksLlpagv +v+g Fsrg++v i ++g+ei++glv+y++++ ++i+g+ks+eie lcl|NCBI__GCF_000009265.1:WP_028742672.1 286 VDDGAVTALGA-GKSLLPAGVRSVSGLFSRGDTVAIIGPAGREIARGLVSYDADDARRIAGRKSAEIET 353 *********99.********************************************************* PP TIGR01027 346 vLgyekkeevvhrdnlvl 363 +Lgy ++ vhrd++v+ lcl|NCBI__GCF_000009265.1:WP_028742672.1 354 ILGYPGRAAMVHRDDMVM 371 ****************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.08 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory