Align Probable fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Probable fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate WP_028950057.1 Q385_RS0101975 fructose-bisphosphate aldolase
Query= curated2:Q9YG90 (272 letters) >NCBI__GCF_000619805.1:WP_028950057.1 Length = 268 Score = 145 bits (367), Expect = 7e-40 Identities = 91/266 (34%), Positives = 148/266 (55%), Gaps = 13/266 (4%) Query: 7 VGKRVRLSRIL--PDGRSVIFAFDHGIEHGPGEIPEERLDPRLLIREVVEAGVDAIMTTP 64 +GKRVRL R++ G++V+ DHG+ GP + ++ + ++++ E G +AI+ Sbjct: 3 IGKRVRLERLINRDTGKTVLVPMDHGVSSGP---MKGIVNLKETVQKIAEGGANAIILHK 59 Query: 65 GIARLTWDIWANRVAMIIKVSGKT--SIRPQDDQFLQSAISSVDEVVALGGDGVAATVYW 122 G+ + +II +S T S+R D + + +V+E + LG DGV+ V Sbjct: 60 GMVEAGHRGKGKDLGLIIHMSASTDLSLRKND----KVLVCTVEEAIKLGADGVSIHVNI 115 Query: 123 GSQFEDKMLERWTRIRLRAEKLGLPALQLAYPRGPHIKNRYAVDIVAYGARAAMETGADL 182 G++ E +ML+ + + + + +P L + Y RGP +KN Y +A+ AR A E GAD+ Sbjct: 116 GAEDEKQMLKDFGEVSKKCLEWQMPLLAMMYYRGPEVKNPYDPKAIAHIARIAAELGADI 175 Query: 183 IKTYYTGSTESFRRVVSAAGGVPVLMSGGARTPSPQEFLHKVY-SVMEAGGGGVVVGRNI 241 +K YTG ESFR VV VPV+++GG + S + L VY +V+ AG G+ +GRNI Sbjct: 176 VKVPYTGDPESFREVVEGC-PVPVVIAGGPKVDSDEALLKMVYDAVVVAGCAGLSIGRNI 234 Query: 242 FQAGDIRAMVKAIRAIVHEGFDPEKA 267 FQ ++ + + IVHEG E+A Sbjct: 235 FQHDNVPLITSVLAKIVHEGISVEEA 260 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 268 Length adjustment: 25 Effective length of query: 247 Effective length of database: 243 Effective search space: 60021 Effective search space used: 60021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory