Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate WP_028950520.1 Q385_RS0104490 glutamate 5-kinase
Query= BRENDA::Q6E235 (370 letters) >NCBI__GCF_000619805.1:WP_028950520.1 Length = 367 Score = 211 bits (536), Expect = 3e-59 Identities = 146/364 (40%), Positives = 206/364 (56%), Gaps = 11/364 (3%) Query: 2 KKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSALGY 61 K +RIV+KIGS L N ID IK+ I + E I+++SGAV AG L Sbjct: 9 KAKRIVIKIGSQILEKDN-DIDTDFIKDLANQIKNYPDK--EFIIVSSGAVLAGVKKLKL 65 Query: 62 PARPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYATVM 121 P++P TI KQA A+VGQ LMQ Y L Q+LLT +R+RY A T+ Sbjct: 66 PSKPKTITEKQAVASVGQAYLMQIYDKIFSEKDLIIGQMLLTIEGLQERKRYLYAKETLN 125 Query: 122 ELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNEN 181 +LLE V+PIINEND+ +VEE+ FGDND LS+ VS L AD L+I++ GLY +P+ + Sbjct: 126 KLLEYKVIPIINENDAIAVEEIVFGDNDYLSSHVSVLADADLLIIISTAGGLYTDDPS-S 184 Query: 182 PDAKRFDYLTDITPELLGYAGSAGSKVGTGGMKSKFLAAQTALSLGVKVFIGTGAGREKL 241 P+A+ + D+ L YA S+ S GTGGM+SK AA+ A S + V I + Sbjct: 185 PNAQLIKEVFDV-DYALNYAKSSKSTFGTGGMRSKLEAAKIATSHSIPVMI-VPKKSGII 242 Query: 242 KVILDGKGDGTYIGDKELSTVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPAGV 301 ++L+G+ GT+I + ++ + W+ S G I++D GAE+A + G SLLP+GV Sbjct: 243 DMVLNGQEVGTFIYPSKKKKMSGKKSWLALLSHPKGRIVVDKGAEKA-LKEGKSLLPSGV 301 Query: 302 ADVCGSF-PKGAVVEVRGPGGIIGKGQTHYSSDEILEAKG---KRSDQLPGAKQVEVIHR 357 +V G F PK V V +IGKG + S ++ + KG K + Q+ G EVIHR Sbjct: 302 KEVEGIFNPKDTVAIVNEENIVIGKGIINLSYKDLKKIKGLKTKEASQILGKDVEEVIHR 361 Query: 358 NDWV 361 ++ V Sbjct: 362 DNLV 365 Lambda K H 0.314 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 367 Length adjustment: 30 Effective length of query: 340 Effective length of database: 337 Effective search space: 114580 Effective search space used: 114580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_028950520.1 Q385_RS0104490 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.17509.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-120 388.6 2.7 1.7e-120 388.4 2.7 1.0 1 lcl|NCBI__GCF_000619805.1:WP_028950520.1 Q385_RS0104490 glutamate 5-kinas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000619805.1:WP_028950520.1 Q385_RS0104490 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 388.4 2.7 1.7e-120 1.7e-120 1 363 [] 11 366 .. 11 366 .. 0.97 Alignments for each domain: == domain 1 score: 388.4 bits; conditional E-value: 1.7e-120 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQ 69 kriV+K+Gs +L+++++ +++ +++l++q+++ + +e +ivsSGav aG+++L lp++pk+++ekQ lcl|NCBI__GCF_000619805.1:WP_028950520.1 11 KRIVIKIGSQILEKDND-IDTDFIKDLANQIKNYPD--KEFIIVSSGAVLAGVKKLKLPSKPKTITEKQ 76 69**********99998.**************9876..69***************************** PP TIGR01027 70 alaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvave 138 a+a+VGQ++Lm+ y+k+fs+ +l ++Q+LLt + l++r+ryl a++tl++lle +v+pi+NEND++ave lcl|NCBI__GCF_000619805.1:WP_028950520.1 77 AVASVGQAYLMQIYDKIFSEKDLIIGQMLLTIEGLQERKRYLYAKETLNKLLEYKVIPIINENDAIAVE 145 ********************************************************************* PP TIGR01027 139 eikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGT 207 ei fGDND Ls v+ l +AdlL++++++ gLy++dp + p+A+li+ev +++ +l++ + ss s++GT lcl|NCBI__GCF_000619805.1:WP_028950520.1 146 EIVFGDNDYLSSHVSVLADADLLIIISTAGGLYTDDP-SSPNAQLIKEVFDVDYALNYAK-SSKSTFGT 212 *************************************.9*************99998877.55688*** PP TIGR01027 208 GGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeak.kkklknrkqwilaaseakGki 275 GGmr+Kleaa++A++ ++v+i+++++ i +l++++vgt++ ++ kkk++ +k w++ +s++kG+i lcl|NCBI__GCF_000619805.1:WP_028950520.1 213 GGMRSKLEAAKIATSHSIPVMIVPKKS-GIIDMVLNGQEVGTFIYPSkKKKMSGKKSWLALLSHPKGRI 280 ************************996.889999************94555****************** PP TIGR01027 276 ivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglkseeie 344 +vd+gae+al+e gksLlp+gv eveg F+ ++v i++ee igkg n s ++l+kikglk++e + lcl|NCBI__GCF_000619805.1:WP_028950520.1 281 VVDKGAEKALKE-GKSLLPSGVKEVEGIFNPKDTVAIVNEENIVIGKGIINLSYKDLKKIKGLKTKEAS 348 ***********9.******************************************************** PP TIGR01027 345 dvLgyekkeevvhrdnlvl 363 ++Lg eev+hrdnlv+ lcl|NCBI__GCF_000619805.1:WP_028950520.1 349 QILGKD-VEEVIHRDNLVI 366 ***876.789******985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.49 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory