Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_028950746.1 Q385_RS0105715 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000619805.1:WP_028950746.1 Length = 375 Score = 369 bits (946), Expect = e-106 Identities = 182/379 (48%), Positives = 251/379 (66%), Gaps = 5/379 (1%) Query: 2 IKSALLVLEDGTQFHGRAIGATGSAVG-EVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI 60 ++ A+L LEDG F+G A + G EV+FNTSMTGYQEILTDPSY QIV +T + Sbjct: 1 MEKAILALEDGHFFYGWAFSSPVKETGGEVIFNTSMTGYQEILTDPSYKGQIVVMTAAEV 60 Query: 61 GNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTR 120 GN G N D++S +V G V++D+P + SN+R + L YL+++N++ I +DTR + R Sbjct: 61 GNYGINTEDDQSDRVWVNGFVVKDVPNLYSNYRAVQSLKEYLEKNNVLGIFGVDTRSIVR 120 Query: 121 LLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGG 180 +LR KG G I GD A A+ KAR+ P ++ ++L EV+ + Y WTQ SW G Sbjct: 121 ILRTKGVMKGYIGVGDISPAE-AVRKARSIPDISELNLVAEVSKPQVYRWTQKSWRWPNG 179 Query: 181 LPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSN 240 E + E + V D+G KR+ILR+L DR L P SAE+VL +NPDGIFLSN Sbjct: 180 YEE---QTEFHYKVAVLDYGVKRDILRLLADRNLELICFPYNASAEEVLSINPDGIFLSN 236 Query: 241 GPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV 300 GPGDPA Y I I+K + ++ P+FGICLGHQLL+ A G++T K++FGHHGGNHPVK++ Sbjct: 237 GPGDPAVLTYQIQQIKKLIASEKPIFGICLGHQLLSWAFGSRTYKLEFGHHGGNHPVKNL 296 Query: 301 EKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP 360 + V ITAQNH +A DE+ LP ++ +TH +L D T++G+ + P FS Q HPEA+PGP Sbjct: 297 KTGRVEITAQNHNYATDESKLPGDVEITHINLNDHTVEGMRHKNYPVFSIQHHPEAAPGP 356 Query: 361 HDAAPLFDHFIELIEQYRK 379 HD+ +FD F LI++ +K Sbjct: 357 HDSFYIFDEFYNLIKECKK 375 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 375 Length adjustment: 30 Effective length of query: 352 Effective length of database: 345 Effective search space: 121440 Effective search space used: 121440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_028950746.1 Q385_RS0105715 (glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.4027737.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-153 494.7 0.0 8.5e-153 494.5 0.0 1.0 1 NCBI__GCF_000619805.1:WP_028950746.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000619805.1:WP_028950746.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 494.5 0.0 8.5e-153 8.5e-153 1 360 [. 4 371 .. 4 372 .. 0.96 Alignments for each domain: == domain 1 score: 494.5 bits; conditional E-value: 8.5e-153 TIGR01368 1 atlvledGtvfegksfgae.kevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkik 72 a+l+ledG++f g++f+++ ke+ Gev+FnTsmtGYqEiltDpsYkgqivv+t+ ++gnyg+n+ed +s++++ NCBI__GCF_000619805.1:WP_028950746.1 4 AILALEDGHFFYGWAFSSPvKETGGEVIFNTSMTGYQEILTDPSYKGQIVVMTAAEVGNYGINTEDDQSDRVW 76 689**************87266779************************************************ PP TIGR01368 73 vkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakes 145 v+g+vvk++ + +snyra +sL+e+l+++++ +i gvDTR++v+ lR+kg+mk++i +++ e+v+ka++ NCBI__GCF_000619805.1:WP_028950746.1 77 VNGFVVKDVPNLYSNYRAVQSLKEYLEKNNVLGIFGVDTRSIVRILRTKGVMKGYIGVGDISPAEAVRKARSI 149 ************************************************************************* PP TIGR01368 146 pkvkevnlvkevstkeayeleqk........akkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsae 210 p+++e+nlv+evs ++y+++qk +++++ +++v+v+d+GvK++ilr L++r++e++ +p+++sae NCBI__GCF_000619805.1:WP_028950746.1 150 PDISELNLVAEVSKPQVYRWTQKswrwpngyEEQTEFHYKVAVLDYGVKRDILRLLADRNLELICFPYNASAE 222 *********************955666667455666669********************************** PP TIGR01368 211 eikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkd 283 e+ ++npdgi+lsnGPGdPa ++++i+++kkl+ +++PifGIclGhqll+ a+g++tykl+fGh+G+Nhpvk+ NCBI__GCF_000619805.1:WP_028950746.1 223 EVLSINPDGIFLSNGPGDPAVLTYQIQQIKKLIASEKPIFGICLGHQLLSWAFGSRTYKLEFGHHGGNHPVKN 295 ************************************************************************* PP TIGR01368 284 lktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefv 356 lktgrveit+qNH+ya de+ l+ +++e+th nlnD+tveg++hk++pvfs+Q+HPea+pGphd+ y+Fdef NCBI__GCF_000619805.1:WP_028950746.1 296 LKTGRVEITAQNHNYATDESKLP-GDVEITHINLNDHTVEGMRHKNYPVFSIQHHPEAAPGPHDSFYIFDEFY 367 *******************9976.77*********************************************** PP TIGR01368 357 elik 360 +lik NCBI__GCF_000619805.1:WP_028950746.1 368 NLIK 371 *997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.98 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory