Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_028990083.1 G579_RS0110090 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000423825.1:WP_028990083.1 Length = 364 Score = 372 bits (955), Expect = e-108 Identities = 194/363 (53%), Positives = 255/363 (70%), Gaps = 4/363 (1%) Query: 3 EADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLK 62 EA L ALR +ID LD+++L+L++ RA A EVA+VK A+ E F+RPEREA VL+ Sbjct: 6 EAKGLAALRRQIDQLDDQLLELLNRRATLAMEVAQVKQAA---GENGTFWRPEREAEVLQ 62 Query: 63 HIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISK 122 +M N GPLD+E +A LFRE+MS+CLALE+PL VAYLGP GTF+Q AA KHFG Sbjct: 63 RVMARNPGPLDSETVAWLFRELMSACLALERPLTVAYLGPAGTFTQMAATKHFGQGARLT 122 Query: 123 PMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLV 182 P+++I EVFR V AG +FGVVPVENSTEG+VN TLD L++ + +CGEV+LR+ H+L+ Sbjct: 123 PVSSIPEVFRTVQAGQADFGVVPVENSTEGSVNLTLDHLLDYPLKVCGEVQLRVVHNLVS 182 Query: 183 GETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGD 242 D + RIY H Q+ AQCR WL H P V+ V V+SNA+AA R + + AI+ Sbjct: 183 AGVPLAD-MQRIYVHYQTRAQCRHWLAEHAPRVQLVEVASNAEAALRAREDAAGGAISTA 241 Query: 243 MAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMP 302 AA+LYGL LA IED N+TRFL+IG +V PTG DKTS+++S N+PG+LHELL P Sbjct: 242 AAAELYGLRILAAGIEDDAENTTRFLVIGDLDVQPTGRDKTSLVLSSHNRPGSLHELLRP 301 Query: 303 FHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPK 362 + GI +TRIE+RP+R G W YVFF+D GH +DP + L ++ +A K+LG+YPK Sbjct: 302 LAAAGISMTRIESRPARRGLWQYVFFLDLEGHAKDPAVAAALAELQEKATFYKLLGTYPK 361 Query: 363 AVL 365 AV+ Sbjct: 362 AVI 364 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 364 Length adjustment: 29 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory