Align Alanine--glyoxylate aminotransferase; AGT; EC 2.6.1.44 (characterized)
to candidate WP_028990417.1 G579_RS0112280 alanine--glyoxylate aminotransferase family protein
Query= SwissProt::Q9W3Z3 (394 letters) >NCBI__GCF_000423825.1:WP_028990417.1 Length = 394 Score = 286 bits (733), Expect = 5e-82 Identities = 156/374 (41%), Positives = 224/374 (59%), Gaps = 4/374 (1%) Query: 16 PSKTLMGPGPSNCSHRVLEAMSNPVLGHMHPECLQIMDEVKEGIKYIFQTLNDATMCISG 75 P +TLMGPGPS+ + RVLEAMS P +GH+ P + +M+E+K ++Y FQT N TM +SG Sbjct: 9 PVRTLMGPGPSDVNPRVLEAMSRPTIGHLDPVFVDMMEELKSLLQYAFQTGNQLTMPVSG 68 Query: 76 AGHSGMEAALCNLIEDGDVVLMGITGVWGHRAGDMARRYGAEVHYVEASFGRALSHEEIT 135 G +GME NL+E GD V++ GV+G R + R G VE ++G A+ +++ Sbjct: 69 PGSAGMETCFVNLVEPGDKVIVCQNGVFGGRMKENVERCGGTAVMVEDAWGSAVDPQKLK 128 Query: 136 FAFEAH-RPKVFFIAQGDSSTGIIQQNIRELGELCRKYDCFLIVDTVASLGGTEFLMDEW 194 A +AH K+ ++STG Q + + L E+ ++DC +IVDTV SLGGT +DEW Sbjct: 129 DALQAHPDAKLVAFVHAETSTG-AQSDAKALVEIAHRHDCLVIVDTVTSLGGTPVKVDEW 187 Query: 195 KVDVAYTGSQKSLGGPAGLTPISFSKRALTRIRKRKTKPKVYYFDILLIGQYWGCYGTPR 254 +D Y+G+QK L GL+P+SFS+RA+ RI+ RKTK + ++ D+ L+ YWG G R Sbjct: 188 GIDAVYSGTQKCLSCTPGLSPVSFSERAMERIKHRKTKVQSWFMDLNLVMGYWGS-GAKR 246 Query: 255 IYHHTISSTLLYGLREALAHFCAVGLKAVVRRHQECSKRLQLGIEELGLEMFVSREEERL 314 YHHT LYGL EAL GL+ RH + L GIE +GL+ FV +E+ERL Sbjct: 247 AYHHTAPINALYGLHEALVILQEEGLENAWARHAHAHRALLAGIEAMGLK-FVVKEDERL 305 Query: 315 PTVNTIKVPFGVDWKKVAEYAMRKYSVEISGGLGPTVEHVFRIGLMGENATVERVDMVLS 374 P +N + +P GVD V ++ Y++EI GLGP ++RIGLMG A + V L Sbjct: 306 PQLNAVGIPEGVDDAAVRAQLLQDYNLEIGAGLGPMAGKIWRIGLMGYGANPKNVLFCLG 365 Query: 375 ILNEAIQSSKLGIK 388 L + + + I+ Sbjct: 366 ALEDVLSRMRAPIE 379 Lambda K H 0.321 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 394 Length adjustment: 31 Effective length of query: 363 Effective length of database: 363 Effective search space: 131769 Effective search space used: 131769 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory