Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_028997757.1 H537_RS0109645 acetylglutamate kinase
Query= curated2:A8AA51 (264 letters) >NCBI__GCF_000430725.1:WP_028997757.1 Length = 303 Score = 112 bits (280), Expect = 9e-30 Identities = 83/257 (32%), Positives = 131/257 (50%), Gaps = 21/257 (8%) Query: 2 IVVKAGGRTLLNN--MDEIVKSISRLE----KAVFVHGGGDLVDEWERKMGMEPQFKVSA 55 IV+K GG + + + + + L+ V VHGGG +DE ++G + QF Sbjct: 38 IVIKYGGNAMTDPALQQDFAEDVVLLKLVGLNPVVVHGGGPQIDEALTRVGKKGQFIQG- 96 Query: 56 SGIKFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPSVIAERKKKVIV 115 R TDE+ +EV VL G + + IV + G AVGLTG DG + A + K V + Sbjct: 97 ----MRVTDEETMEVVEWVLAGQVQQDIVGLINAAGGKAVGLTGRDGGMIRARKLKMVDL 152 Query: 116 QEKVGERLVKRAIAGGYTGKIKEVKTDLIKALVERGLVPVVAPIALSPEGELLNVNGDQM 175 + ++ G G+I+ + ++KAL + +PV++PI + E N+N D + Sbjct: 153 NDP------EKLHDVGQVGEIESIDPSVVKALQDDQFIPVISPIGFGKDNESYNINADLV 206 Query: 176 AAELAKALSAEYLVLLTDVPGVL-MDGKVVPEIKSSEAEEVAK--KVGPGMNIKIIMAGR 232 A +LA+ L AE LVLLT++ GVL +G+++ ++ + +E+ + GM KI A Sbjct: 207 AGKLAEVLRAEKLVLLTNIKGVLDKEGQLLTDLTAKRIDELFADGTISGGMLPKIASALD 266 Query: 233 VASGGTKVV-ICDGTVP 248 A G V I DG VP Sbjct: 267 AAKNGVNAVHIIDGRVP 283 Lambda K H 0.316 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 303 Length adjustment: 26 Effective length of query: 238 Effective length of database: 277 Effective search space: 65926 Effective search space used: 65926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory