Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate WP_029000552.1 H537_RS0128300 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >NCBI__GCF_000430725.1:WP_029000552.1 Length = 427 Score = 479 bits (1233), Expect = e-140 Identities = 233/418 (55%), Positives = 320/418 (76%), Gaps = 5/418 (1%) Query: 3 YFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAVKA 62 + + DG+L+ E L LA ++GTPLYVYSR + A++K++ HL+CYA+KA Sbjct: 9 FLQRRADGRLYFEDCALDALAREHGTPLYVYSRGAMRAALAAYEKALAGRAHLLCYAMKA 68 Query: 63 NSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKC 122 NS+L VL A+ G GFDIVS GEL+RVLAAG D KVVFSGVGKT AEM++ALQ ++C Sbjct: 69 NSSLAVLQLFAQAGCGFDIVSGGELQRVLAAGADAGKVVFSGVGKTPAEMRQALQAGVRC 128 Query: 123 FNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQV 182 FNVESE EL RL++VA +G +AP+SLR+NPDVDAKTHPYISTGL+ NKFGI+ RA V Sbjct: 129 FNVESEAELDRLSQVAQGMGRRAPVSLRVNPDVDAKTHPYISTGLKGNKFGISHQRALDV 188 Query: 183 YRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLG 242 Y+ A +LP L+V GIDCHIGSQ+T + P++DA +R+L L+++++A+GI + HLD+GGGLG Sbjct: 189 YKHAAALPGLEVVGIDCHIGSQITEIGPYLDALERVLDLVEAVEAQGITLHHLDLGGGLG 248 Query: 243 VVYRDELPPQPSEYAKALLDRLER--HRDLELIFEPGRAIAANAGVLVTKVEFLK--HTE 298 + Y DE PP P ALL+R++ H E++ EPGR++ NAGVL+T+V++LK E Sbjct: 249 ITYTDEAPPTPDALVTALLERIDARGHGHREILMEPGRSLVGNAGVLLTEVQYLKPSEVE 308 Query: 299 HKNFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGE-AQTYDLVGPVCETSDFLGKDRDLV 357 K+F I+DAAMNDL+RPA+Y+AW I+P R GE A+T+D+VGPVCE+ D+LG++R L Sbjct: 309 GKHFCIVDAAMNDLMRPAMYEAWMGIVPCVERAGEAAETWDVVGPVCESGDWLGRERTLA 368 Query: 358 LQEGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVL 415 ++EGD+LAV S+GAYG +M+SNYNTRPR AEVMV+G++ + +R+RE++ L+A E ++ Sbjct: 369 VREGDVLAVLSAGAYGMSMASNYNTRPRAAEVMVEGSQAWCIREREKVEDLFAHERLI 426 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 427 Length adjustment: 32 Effective length of query: 385 Effective length of database: 395 Effective search space: 152075 Effective search space used: 152075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_029000552.1 H537_RS0128300 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.18168.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-162 526.5 0.0 2.1e-162 526.3 0.0 1.0 1 lcl|NCBI__GCF_000430725.1:WP_029000552.1 H537_RS0128300 diaminopimelate d Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000430725.1:WP_029000552.1 H537_RS0128300 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 526.3 0.0 2.1e-162 2.1e-162 3 416 .. 12 423 .. 10 424 .. 0.98 Alignments for each domain: == domain 1 score: 526.3 bits; conditional E-value: 2.1e-162 TIGR01048 3 ekkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllae 71 ++ dg+l+ e+++l +la+e+gtPlYvy++ ++r++l+a+++a +++ +l++YA+KAns+lavl+l+a+ lcl|NCBI__GCF_000430725.1:WP_029000552.1 12 RRADGRLYFEDCALDALAREHGTPLYVYSRGAMRAALAAYEKALAGRAHLLCYAMKANSSLAVLQLFAQ 80 56799******************************************9********************* PP TIGR01048 72 eGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgk 140 +G+g+d+vsgGEl+r+laAg++a k+vfsg+gk+ +e+++al+++++++nv+s++el++l+++a+++g lcl|NCBI__GCF_000430725.1:WP_029000552.1 81 AGCGFDIVSGGELQRVLAAGADAGKVVFSGVGKTPAEMRQALQAGVRCFNVESEAELDRLSQVAQGMGR 149 ********************************************************************* PP TIGR01048 141 karvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfv 209 +a+v+lRvnpdvdakth+yisTGlk +KFGi++++a+++y+ a++l+ le+vGi++HIGSqi+++ p+ lcl|NCBI__GCF_000430725.1:WP_029000552.1 150 RAPVSLRVNPDVDAKTHPYISTGLKGNKFGISHQRALDVYKHAAALPGLEVVGIDCHIGSQITEIGPYL 218 ********************************************************************* PP TIGR01048 210 eaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelgl.klklilE 277 +a+e+v++l+e ++++gi+l++ldlGGGlgi+y++e +p+++ ++ +lle++ + g+ + ++++E lcl|NCBI__GCF_000430725.1:WP_029000552.1 219 DALERVLDLVEAVEAQGITLHHLDLGGGLGITYTDEA-PPTPDALVTALLERIDAR---GHgHREILME 283 ***********************************99.**********99988884...77699***** PP TIGR01048 278 pGRslvanagvlltrVesvKeves..rkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvG 344 pGRslv+nagvllt+V+++K +e+ ++f++vDa+mndl+Rpa+Yea++ i+++ + e++et+dvvG lcl|NCBI__GCF_000430725.1:WP_029000552.1 284 PGRSLVGNAGVLLTEVQYLKPSEVegKHFCIVDAAMNDLMRPAMYEAWMGIVPCVERAGEAAETWDVVG 352 ********************888777****************************999999********* PP TIGR01048 345 plCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledll 413 p+CEsgD l+++r+l e Gd+lav saGAYg+sm+snYn+rpr+aev+ve+ +a ir+re++edl+ lcl|NCBI__GCF_000430725.1:WP_029000552.1 353 PVCESGDWLGRERTLAVRE-GDVLAVLSAGAYGMSMASNYNTRPRAAEVMVEGSQAWCIREREKVEDLF 420 ***************8665.************************************************* PP TIGR01048 414 ale 416 a+e lcl|NCBI__GCF_000430725.1:WP_029000552.1 421 AHE 423 987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (427 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.99 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory