Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_029001770.1 H537_RS0136235 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000430725.1:WP_029001770.1 Length = 424 Score = 289 bits (740), Expect = 2e-82 Identities = 167/420 (39%), Positives = 263/420 (62%), Gaps = 20/420 (4%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 +++V K+GG ++ E++ VA+++ K ++G + VVV SAM T+ L+ LAK + Sbjct: 2 ALIVHKYGGTSMGSTERIRNVAKRVAKWARAGHQMVVVPSAMSGETNRLLGLAKELSPKQ 61 Query: 399 DP----RELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDIN 454 RELD++ +TGE SV L++IAL+ G +AIS+TG Q+ + TD Y ARI I+ Sbjct: 62 TSSALLRELDMIAATGEQVSVGLLAIALQAEGMEAISYTGWQVPVQTDSAYTKARIESID 121 Query: 455 TDIISRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDG 514 + L + ++ GFQGI G ITTLGRGGSD +A+A+A ++ AD C +Y DVDG Sbjct: 122 DARVRADLAAGKVVIITGFQGIDAEGHITTLGRGGSDTSAVAVAAAMKADECLIYTDVDG 181 Query: 515 VYTADPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNA------ 568 VYT DPR+V +AR + +S+EEM+E++ G++VLQ R+ EFA KY V + + ++ Sbjct: 182 VYTTDPRVVAEARRLSTVSFEEMLEMASLGSKVLQIRSVEFAGKYRVPLRVLSSFTPWDI 241 Query: 569 --HKETR-GTLIW--EGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMG 623 +E R GTLI E K+E +V + F AK+ + VPDKPG+A +I+ +++ Sbjct: 242 DIEEEARSGTLITFEEDEKMEQAVVSGIAFNRDEAKITVMGVPDKPGIAYQILGAVAEAN 301 Query: 624 VNIDMIIQGMKSGEYNTVAFIVPESQLGKLDIDLLKTR----SEAKEIIIEKGLAKVSIV 679 +++D+IIQ + +F V + + +DLL+++ AKEI+ + + KVSIV Sbjct: 302 IDVDVIIQNVSHDGKTDFSFTVHRNDYQR-TVDLLQSQVLPALGAKEILGDTKICKVSIV 360 Query: 680 GVNLTSTPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDRE 739 G+ + S +++ +F +L++EGINI MI+ S + SV+ID KY+E AV+A+H FELD+E Sbjct: 361 GIGMRSHAGVASKMFRSLSDEGINIQMITTSEIKTSVVIDEKYMELAVRALHRAFELDQE 420 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 683 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 424 Length adjustment: 36 Effective length of query: 703 Effective length of database: 388 Effective search space: 272764 Effective search space used: 272764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory