Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate WP_029132074.1 A3GO_RS0102565 N-acetylglutaminylglutamine amidotransferase
Query= CharProtDB::CH_007942 (614 letters) >NCBI__GCF_000428045.1:WP_029132074.1 Length = 593 Score = 258 bits (658), Expect = 7e-73 Identities = 171/540 (31%), Positives = 274/540 (50%), Gaps = 25/540 (4%) Query: 1 MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDI-EGG 59 MCGI G + + + RMT L +RGPD + + + FGH+RLA++D+ E Sbjct: 1 MCGICGELRLDGGR-PDLGAISRMTARLDRRGPDHEGSYSDGPLAFGHRRLAIIDLSERA 59 Query: 60 RQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVD 119 QPM G +++NG +YN LR+ L+ +G+ F D+EV+L ++ W + CV+ Sbjct: 60 NQPMVDQELG--LALVFNGTIYNYPALRETLKQKGYHFYSDGDSEVILKAWHAWGDRCVE 117 Query: 120 HLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDR 179 L G+FAFA+WD+ + LF ARDR+G+KPF+Y+ S F F S ++A+LA + +D Sbjct: 118 QLQGMFAFAIWDQGKKQLFMARDRMGIKPFYYSHSDSQFRFASNVQALLASGGVDISLDA 177 Query: 180 TGLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNI-WRYWNVESEK--HTDSFD 236 L F L I +G++++ P H+L DG RYW + + + S Sbjct: 178 VALHNQFTLHAVVPAPRTILQGVRKLAPGHSLLLDADGKRTERRYWQLSATRPARPRSDG 237 Query: 237 DTVANVRSLFQDAV-TRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSID 295 + + ++ + AV R +SDVPV LSGGLDSS + A+ A + G + L T+S+ Sbjct: 238 EWLESIHDALRLAVHKRNNISDVPVGVLLSGGLDSSLLVALLA----ESGVSDLRTFSVG 293 Query: 296 YEENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMA 355 +E++ + S F+ +D ++ E +GTTHHK +I ++++ L EAV P Sbjct: 294 FEDHPDE-KGSEFEYSD------QVVERYGTTHHKYLIPNEEVLKRLPEAVDAMAEPMFG 346 Query: 356 DVDSSLLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVE-SGFPWMRSTEERIKLLS 414 + ++ K V SG+ ADE+FGGY W+ E G P R Sbjct: 347 QDAVAFYLLSEQVSKQIKVVQSGQGADEVFGGYFWYSRMMAEQQGSPVERFARHYFDRDH 406 Query: 415 DSWQKKLNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMT-NLLDRKDRM 473 + + + + + + + +AE L GE G D + +++ + + + R D M Sbjct: 407 EEYLRMVTAEYRGDDYTSQHIAE---LLGEPGADSFMDAVLRMDVTTLIVDDPVKRVDNM 463 Query: 474 SMGASLEVRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYP 533 +M LE RVPF D +LVE P E+K+ + K L+ GILPD ++ R K +P Sbjct: 464 TMAWGLEARVPFLDQQLVELAAQCPPELKLREG-GKYPLKAMARGILPDSVIDRPKGYFP 522 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 904 Number of extensions: 31 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 614 Length of database: 593 Length adjustment: 37 Effective length of query: 577 Effective length of database: 556 Effective search space: 320812 Effective search space used: 320812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate WP_029132074.1 A3GO_RS0102565 (N-acetylglutaminylglutamine amidotransferase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.8648.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-141 456.9 0.0 6.6e-141 456.7 0.0 1.0 1 lcl|NCBI__GCF_000428045.1:WP_029132074.1 A3GO_RS0102565 N-acetylglutaminy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000428045.1:WP_029132074.1 A3GO_RS0102565 N-acetylglutaminylglutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.7 0.0 6.6e-141 6.6e-141 1 516 [. 2 520 .. 2 521 .. 0.90 Alignments for each domain: == domain 1 score: 456.7 bits; conditional E-value: 6.6e-141 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsne 68 Cgi g + l+ + + ai++m+ +l +RGPD+eg ++d ++ghrRLaiidlse +QP+ ++ lcl|NCBI__GCF_000428045.1:WP_029132074.1 2 CGICGELRLDGG-RPDLGAISRMTARLDRRGPDHEGSYSD---GPLAFGHRRLAIIDLSERaNQPMVDQ 66 999999999775.44689*******************999...8***************999******* PP TIGR01536 69 k.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgel 136 + ++vfnG IYN+ +Lre+l++kGy+F ++ D+EViL+a+++wg ++ve+L+GmFAfa+wd+ k++l lcl|NCBI__GCF_000428045.1:WP_029132074.1 67 ElGLALVFNGTIYNYPALRETLKQKGYHFYSDGDSEVILKAWHAWGDRCVEQLQGMFAFAIWDQGKKQL 135 **99***************************************************************** PP TIGR01536 137 flaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlq.lvptektlfkevkele 204 f+aRDr+GikP+Yy+ ++++ faS ++alla ++ +ld+ al++++tl+ +vp ++t+ ++v++l lcl|NCBI__GCF_000428045.1:WP_029132074.1 136 FMARDRMGIKPFYYSHSDSQFRFASNVQALLASGGVDISLDAVALHNQFTLHaVVPAPRTILQGVRKLA 204 ****************************************************999************** PP TIGR01536 205 pakal....dgeekleeywevekee..vkeseeelveelrelledavkkrlv.advpvgvllSGGlDSs 266 p+++l dg+++ ++yw+++ ++ + s+ e e++ ++l+ av+kr +dvpvgvllSGGlDSs lcl|NCBI__GCF_000428045.1:WP_029132074.1 205 PGHSLlldaDGKRTERRYWQLSATRpaRPRSDGEWLESIHDALRLAVHKRNNiSDVPVGVLLSGGLDSS 273 *****998777777777***99988667788999**************99766**************** PP TIGR01536 267 lvaaiakkeaksevktFsigfedskdldesk..aarkvadelgtehkevliseeevlkeleevilalee 333 l++a++++ s+++tFs+gfed++d + s+ + +v++ gt+h+++li +eevlk l+e + a+ e lcl|NCBI__GCF_000428045.1:WP_029132074.1 274 LLVALLAESGVSDLRTFSVGFEDHPDEKGSEfeYSDQVVERYGTTHHKYLIPNEEVLKRLPEAVDAMAE 342 ******999999**********8877765554499********************************** PP TIGR01536 334 ptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeealelpeaselaekklllqakl 402 p+ ++++ ylls++++++ +kVv sG+GaDE+fgGY ++ ++ ae++ p +++ +++ + lcl|NCBI__GCF_000428045.1:WP_029132074.1 343 PMFGQDAVAFYLLSEQVSKQ-IKVVQSGQGADEVFGGYFWYSRMMAEQQGS-PV-ERF--ARHYFD--- 403 ********************.**********************98888775.22.221..222222... PP TIGR01536 403 akeselkellkakleeelkekeelkkelkee...seleellrldlelllsdl.lrakDrvsmahslEvR 467 +++ e +++ a+++ + ++++ ++ l e s ++++lr d+++l+ d+ +++ D ++ma++lE+R lcl|NCBI__GCF_000428045.1:WP_029132074.1 404 RDHEEYLRMVTAEYRGDDYTSQHIAELLGEPgadSFMDAVLRMDVTTLIVDDpVKRVDNMTMAWGLEAR 472 23444556666666666655555555555545559*********9998776626666************ PP TIGR01536 468 vPflDkelvelalsippelklrdgkeKvlLreaaeellPeeileRkKea 516 vPflD++lvela++ ppelklr+g K+ L+ +a+++lP+++ +R+K lcl|NCBI__GCF_000428045.1:WP_029132074.1 473 VPFLDQQLVELAAQCPPELKLREG-GKYPLKAMARGILPDSVIDRPKGY 520 *********************987.7********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (593 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.02 # Mc/sec: 10.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory