Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_029132260.1 A3GO_RS0103725 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::A0A140ND68 (396 letters) >NCBI__GCF_000428045.1:WP_029132260.1 Length = 396 Score = 507 bits (1305), Expect = e-148 Identities = 242/396 (61%), Positives = 305/396 (77%) Query: 1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE 60 MFE ++AAPADPILGL + F+ D R KINLG+G+YKDE G TP+L+ VKKAE+ LL E Sbjct: 1 MFEQLSAAPADPILGLTEAFKKDTRTDKINLGVGIYKDEAGTTPILSCVKKAEERLLSQE 60 Query: 61 TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV 120 T+K+YL I+G PE+G Q LLFG S +I RAR+A PGGTGALR+ A+F+A++ Sbjct: 61 TSKSYLSIEGTPEYGLGVQRLLFGSDSDIIRAGRARSAHAPGGTGALRICAEFIARHMPS 120 Query: 121 KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC 180 +R+WVSNP+W NH ++F +AGLEV Y YY+AE DF A+ NSL + AGD VLFHGC Sbjct: 121 RRIWVSNPTWANHGNIFQAAGLEVATYDYYNAEAKDKDFAAMKNSLLQVAAGDTVLFHGC 180 Query: 181 CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV 240 CHNPTGIDPT ++W+ LA+LS GWLPLFDFAYQGFA+G+E+DA GLR F + EL+V Sbjct: 181 CHNPTGIDPTADEWEELARLSAAGGWLPLFDFAYQGFAKGIEDDAAGLRIFTEHNPELLV 240 Query: 241 ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN 300 ASS+SKNFGLYNERVG TL+A +++ D AFSQ+K+ IRANYSNPP HG+ +V TIL+N Sbjct: 241 ASSFSKNFGLYNERVGGITLLAKEADQADNAFSQIKSIIRANYSNPPFHGSGIVTTILNN 300 Query: 301 DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR 360 +L A WE+E+ +MR RIQ MR LFV TL+EKG ++DFSFI +Q GMFSFSGL +QV R Sbjct: 301 ASLYAEWEKEVAEMRNRIQAMRDLFVATLKEKGVDQDFSFISRQCGMFSFSGLNPDQVKR 360 Query: 361 LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396 L++EFG+Y V SGR++VAGMT +NM LC I VL Sbjct: 361 LKDEFGIYIVGSGRISVAGMTRNNMDALCSGIAQVL 396 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 396 Length adjustment: 31 Effective length of query: 365 Effective length of database: 365 Effective search space: 133225 Effective search space used: 133225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory