Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_029132662.1 A3GO_RS0106145 threonine synthase
Query= BRENDA::Q8YFS0 (463 letters) >NCBI__GCF_000428045.1:WP_029132662.1 Length = 460 Score = 409 bits (1052), Expect = e-119 Identities = 220/460 (47%), Positives = 299/460 (65%), Gaps = 7/460 (1%) Query: 1 MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT 60 M+YVSTRG + FS A++ GLA DGGL LP+ +PQ A ++ + +A+ V+ Sbjct: 1 MRYVSTRGGIEPVTFSQAVMMGLATDGGLLLPESFPQIDATTLQRWAELPFKALAVEVMY 60 Query: 61 PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA 120 P+ G +I + E++V E+Y +F H V P+V+ + +LELFHGPT AFKDVA+Q L Sbjct: 61 PYVGEDISRVELEKLVEESYASFSHPEVTPVVEV-GDLRILELFHGPTAAFKDVALQFLG 119 Query: 121 RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS 180 + + +L + G R I+GATSGDTG AAI G++ DIFIL P GRVSP+Q+RQMT+ Sbjct: 120 NLFELLLERSGGRLNILGATSGDTGSAAIYGVRGQERIDIFILHPKGRVSPIQERQMTTV 179 Query: 181 GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTA--A 238 +NVH ++I G FDD Q +VK +FNDL F +L VNSINWARI+ QVVYYF A Sbjct: 180 LDANVHNIAITGTFDDGQRIVKELFNDLAFKQEYTLGAVNSINWARILAQVVYYFYAWGR 239 Query: 239 LSLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMR 298 +S G D+ V+F+VPTGNFGDIFAGYVA RMGLP+E+LI+ATN NDILSR + SG Y+ Sbjct: 240 VSGGDVDQKVTFSVPTGNFGDIFAGYVAMRMGLPVERLILATNRNDILSRFVNSGVYQTG 299 Query: 299 GVAQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEF 358 V T SPSMDIQISSNFER L+ +D A VR LM + + G + + + + + F Sbjct: 300 EVYPTISPSMDIQISSNFERYLYYLMDQDPAKVRALMDQMGREGKLEVPAEKRAEVAALF 359 Query: 359 SAGRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDA 418 A + +ET I ++ GY+LDPH+A+GV A+E + LATAHPAKF A Sbjct: 360 QAAAVSEEETRDQIRDTYAQTGYILDPHTAVGVHAAKEIPGA----ICLATAHPAKFGAA 415 Query: 419 VKAACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVR 458 VK A GVE + PA L LM+++ VL + ++ ++++ Sbjct: 416 VKEAIGVESEPPASLQGLMEKETRCAVLEADAAVIRDFMK 455 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 460 Length adjustment: 33 Effective length of query: 430 Effective length of database: 427 Effective search space: 183610 Effective search space used: 183610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_029132662.1 A3GO_RS0106145 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.28798.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-92 294.0 0.0 1e-91 293.6 0.0 1.0 1 lcl|NCBI__GCF_000428045.1:WP_029132662.1 A3GO_RS0106145 threonine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000428045.1:WP_029132662.1 A3GO_RS0106145 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 293.6 0.0 1e-91 1e-91 12 331 .. 69 420 .. 58 426 .. 0.92 Alignments for each domain: == domain 1 score: 293.6 bits; conditional E-value: 1e-91 TIGR00260 12 ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlc 78 +l++l e s++ f p+++ v++ +l ++elfhgPt aFKD++lqf+++l++ +le+ +l+ lcl|NCBI__GCF_000428045.1:WP_029132662.1 69 RVELEKLVEESYASFSHPEVTPVVEVGDLRILELFHGPTAAFKDVALQFLGNLFELLLERSGGrlNILG 137 5678999**************************************************998554459*** PP TIGR00260 79 AtsGdtgaaaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdlvkeife. 145 AtsGdtg+aa+++ +g++ +++++L Pkg++sp+ + +++t+l+ n++ +ai+G+FDd q++vke+f+ lcl|NCBI__GCF_000428045.1:WP_029132662.1 138 ATSGDTGSAAIYGVRGQERIDIFILHPKGRVSPIqERQMTTVLDANVHNIAITGTFDDGQRIVKELFNd 206 **********************************999******************************96 PP TIGR00260 146 ..dkeklklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpi 211 k+++ l++vNsin+ari+aq+ +y++ g++ +kv+++vp gnfg+i++G+++++++ lp+ lcl|NCBI__GCF_000428045.1:WP_029132662.1 207 laFKQEYTLGAVNSINWARILAQVvYYFYAWGRVSGGDVDQKVTFSVPTGNFGDIFAGYVAMRMG-LPV 274 55566*******************666666667777799*************************9.**9 PP TIGR00260 212 eklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnverale.larrslgnledlke..... 274 e l a++ + di+ rf +sg ++ e T+s++mdi ++sn+er l l+ + +++ +l lcl|NCBI__GCF_000428045.1:WP_029132662.1 275 ERLILATNRN-DILSRFVNSGVYQTGEVYPTISPSMDIQISSNFERYLYyLMDQDPAKVRALMDqmgre 342 9999999998.**********55555666******************999999999999999779999* PP TIGR00260 275 ....................svsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaK 323 +vs+ee+ ++i+ +++ gy+l+phtav+v a k+ + ata+paK lcl|NCBI__GCF_000428045.1:WP_029132662.1 343 gklevpaekraevaalfqaaAVSEEETRDQIRDTYAQTGYILDPHTAVGVHAAKEIPGAICLATAHPAK 411 *****************************************************999887777******* PP TIGR00260 324 Feevve.al 331 F +v a+ lcl|NCBI__GCF_000428045.1:WP_029132662.1 412 FGAAVKeAI 420 **9998554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (460 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.02 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory