Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_029133694.1 A3GO_RS0112575 phosphoserine phosphatase SerB
Query= SwissProt::Q9S281 (410 letters) >NCBI__GCF_000428045.1:WP_029133694.1 Length = 403 Score = 282 bits (721), Expect = 1e-80 Identities = 174/400 (43%), Positives = 239/400 (59%), Gaps = 18/400 (4%) Query: 12 LLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEPPRGLEGDLRAT 71 +L+ + GKD PG+TA L LA + ++++D+ Q V + L L+ PP G + Sbjct: 5 ILLNVTGKDHPGLTASLTGVLADHRINILDLGQAVIHDHLSLGMLLEIPPEAQSGPVIKD 64 Query: 72 VHSWAESLKLQAEIISGIGDNR------PRGFGRSLVTVLGHPLTAEATAAIAARITESG 125 + A L LQ + I + +G R +VT+LG L+A A +A ++ G Sbjct: 65 LLFQAHQLGLQINF-TPIDEEAYETWVSHQGKLRYIVTLLGRKLSASTIAHVAQVVSGHG 123 Query: 126 SNIDRIFRLA---------KYPVTAVEFAVSGVETE--PLRTALATEAAALGVDIAVVAA 174 NID I RL+ + VEF V G + LR L ++ VD+A A Sbjct: 124 MNIDGITRLSGRFSLRSANPHRRACVEFTVRGEPADLGALRQDLLEISSRDAVDVAFQAD 183 Query: 175 GLHRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHARVA 234 L+RR +RL+V D+DSTLIQ EVI+ A AG D VA +T +AM+GE+DF +S R+A Sbjct: 184 DLYRRNRRLIVFDMDSTLIQVEVIDELAKAAGVGDAVAAITESAMQGEIDFNESFRRRMA 243 Query: 235 LLAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLDFA 294 LL GLD SV+ + + +T GA LI LKRLGYQVG++SGGF+ LQE+LG+DF Sbjct: 244 LLKGLDESVLAGIAERLPITEGAERLISNLKRLGYQVGILSGGFSYFARHLQEKLGVDFF 303 Query: 295 QANTLEIVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLNAA 354 AN L+I +GRLTG V GEIV+ A KA L+++ A G+ L Q +A+GDGANDL ML+ A Sbjct: 304 SANELDIRNGRLTGEVKGEIVNGARKAELMQQMARDRGISLEQVIAVGDGANDLPMLSLA 363 Query: 355 GLGVAFNAKPVVREAAHTAVNVPFLDTVLYLLGITREEVE 394 GLGVAF+AKPVVRE A A++ LD +LYLLG+ EV+ Sbjct: 364 GLGVAFHAKPVVRENARHAISTLGLDGILYLLGVRDREVK 403 Lambda K H 0.319 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 403 Length adjustment: 31 Effective length of query: 379 Effective length of database: 372 Effective search space: 140988 Effective search space used: 140988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_029133694.1 A3GO_RS0112575 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.3861.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-85 272.4 0.1 1.8e-85 272.0 0.1 1.1 1 lcl|NCBI__GCF_000428045.1:WP_029133694.1 A3GO_RS0112575 phosphoserine pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000428045.1:WP_029133694.1 A3GO_RS0112575 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 272.0 0.1 1.8e-85 1.8e-85 2 219 .] 178 395 .. 177 395 .. 0.98 Alignments for each domain: == domain 1 score: 272.0 bits; conditional E-value: 1.8e-85 TIGR00338 2 iakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllk 70 +a + + ++++++l+vfD+Dstli+ EvIde+ak+aGv+++V++iTe+Am+ge+dF+es+r R++llk lcl|NCBI__GCF_000428045.1:WP_029133694.1 178 VAFQADDLYRRNRRLIVFDMDSTLIQVEVIDELAKAAGVGDAVAAITESAMQGEIDFNESFRRRMALLK 246 67777888999********************************************************** PP TIGR00338 71 glpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkl 139 gl++++l ++e+l++teG+e l+++Lk+ gy+v ++SGgF+++a +l+ekLg+d+ aN+L++++g+l lcl|NCBI__GCF_000428045.1:WP_029133694.1 247 GLDESVLAGIAERLPITEGAERLISNLKRLGYQVGILSGGFSYFARHLQEKLGVDFFSANELDIRNGRL 315 ********************************************************************* PP TIGR00338 140 tGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadivie 208 tG+v+geiv+ ka+ +++++++ gisle+++avGDGanDl+m++ Aglg+af+akpv++e+a ++i+ lcl|NCBI__GCF_000428045.1:WP_029133694.1 316 TGEVKGEIVNGARKAELMQQMARDRGISLEQVIAVGDGANDLPMLSLAGLGVAFHAKPVVRENARHAIS 384 ********************************************************************* PP TIGR00338 209 kkdltdilell 219 + l +il+ll lcl|NCBI__GCF_000428045.1:WP_029133694.1 385 TLGLDGILYLL 395 ******99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (403 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.73 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory