Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_029151571.1 METMI_RS0108775 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_000384075.1:WP_029151571.1 Length = 437 Score = 422 bits (1085), Expect = e-122 Identities = 212/432 (49%), Positives = 299/432 (69%), Gaps = 3/432 (0%) Query: 3 DYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRP 62 ++VNW R +SPYI++HR++TFV+ GE V +F + VHD LL+SLG RLVLVHG RP Sbjct: 6 EFVNWFRSSSPYIHAHRNKTFVISFGGEAVLAADFEHHVHDFALLNSLGIRLVLVHGIRP 65 Query: 63 QIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLR 122 QI+ RL PR+H LR+TD L+ V +A G +R+ IEA LS+ +A SPM GA+++ Sbjct: 66 QIDQRLH-NSAPPRFHNHLRITDDLALQAVKEAAGLVRVEIEALLSLGLANSPMAGAKIK 124 Query: 123 VAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNL 182 VA GN VTA+P+GV++G+DY HTGEVRRID + I + LD+ ++VL+SP+GYSP+GEIFNL Sbjct: 125 VASGNFVTAKPLGVIDGIDYCHTGEVRRIDSEAIHQQLDQDNVVLISPIGYSPSGEIFNL 184 Query: 183 ACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGNSYQ--AEL 240 + E VA AI L+AEKL+L + SGK ++++ ++ A L + N ++ ++ Sbjct: 185 SAEQVATAVAIALKAEKLVLLTEQSCCHPDSGKPIQQMTTAEISAFLDKHPNLHETMSQP 244 Query: 241 LDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLI 300 L AA AC +G+ R H++ T++GALL ELFTR G GTL++ FE LR A + D+GG++ Sbjct: 245 LKAAIHACNSGIARVHLIDRTQNGALLLELFTRDGIGTLISSNPFEDLRPASLHDIGGIL 304 Query: 301 ELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNP 360 ELI+PLE+QG+L +RSRE +E EI + I+ER+GLII C AL+ G +ACLAV+P Sbjct: 305 ELIKPLEQQGVLAKRSREKIEMEIADYFIIERDGLIIGCIALHADLQRHFGVIACLAVHP 364 Query: 361 EYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYN 420 +YR R + LL+ +A+ L LK +FVL+T+T HWF ERGF S + LP +LYN Sbjct: 365 DYRRSARANRLLDYASRKAKQLNLKKIFVLSTQTVHWFIERGFLSSDITNLPEPLKALYN 424 Query: 421 FQRNSQVFEKSL 432 QRNS++ K + Sbjct: 425 PQRNSKILCKDI 436 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 437 Length adjustment: 32 Effective length of query: 400 Effective length of database: 405 Effective search space: 162000 Effective search space used: 162000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_029151571.1 METMI_RS0108775 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.31933.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-166 541.0 0.0 1.2e-166 540.8 0.0 1.0 1 lcl|NCBI__GCF_000384075.1:WP_029151571.1 METMI_RS0108775 amino-acid N-ace Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_029151571.1 METMI_RS0108775 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 540.8 0.0 1.2e-166 1.2e-166 1 428 [. 7 435 .. 7 436 .. 0.98 Alignments for each domain: == domain 1 score: 540.8 bits; conditional E-value: 1.2e-166 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrg 69 fv+w+r+++Pyi+ahr+kt+v+ +gge+v + +++ v+d all+slG+rlvlvhG rpqi++rl + lcl|NCBI__GCF_000384075.1:WP_029151571.1 7 FVNWFRSSSPYIHAHRNKTFVISFGGEAVLAADFEHHVHDFALLNSLGIRLVLVHGIRPQIDQRLH-NS 74 8***************************************************************97.56 PP TIGR01890 70 rtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvd 138 +++++ lr+td+ +l+ vkeaaG +r +iea ls lan+pmag++++v+sGnfvta+P+Gv++G+d lcl|NCBI__GCF_000384075.1:WP_029151571.1 75 APPRFHNHLRITDDLALQAVKEAAGLVRVEIEALLSLGLANSPMAGAKIKVASGNFVTAKPLGVIDGID 143 79******************************************************************* PP TIGR01890 139 yehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGil 207 y+htGevr+id+e+i+++ld+ ++vl+sP+g+s++Geifnl++e+vat vai+lka+kl+llte+ lcl|NCBI__GCF_000384075.1:WP_029151571.1 144 YCHTGEVRRIDSEAIHQQLDQDNVVLISPIGYSPSGEIFNLSAEQVATAVAIALKAEKLVLLTEQSCCH 212 ********************************************************************* PP TIGR01890 208 dadGklvaelsaqeveslverle..eettarllsaavkalrgGvarshlvsyaedGallqelftrdGiG 274 +Gk ++++++ e+ + +++ +et ++ l+aa++a+++G+ar+hl++ ++Gall+elftrdGiG lcl|NCBI__GCF_000384075.1:WP_029151571.1 213 PDSGKPIQQMTTAEISAFLDKHPnlHETMSQPLKAAIHACNSGIARVHLIDRTQNGALLLELFTRDGIG 281 *****************998865124667899************************************* PP TIGR01890 275 tlvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypya 343 tl+s + +e +r a ++d+ggileli+Ple+qG+l +rsre +e ei+++ +ie+dGliigc al++ lcl|NCBI__GCF_000384075.1:WP_029151571.1 282 TLISSNPFEDLRPASLHDIGGILELIKPLEQQGVLAKRSREKIEMEIADYFIIERDGLIIGCIALHADL 350 ********************************************************************* PP TIGR01890 344 eeevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPear 412 + + g +aclav+P++r + r +rll +a+q+ lk++fvl+t+t hWf erGf ++++ +lPe lcl|NCBI__GCF_000384075.1:WP_029151571.1 351 QRHFGVIACLAVHPDYRRSARANRLLDYASRKAKQLNLKKIFVLSTQTVHWFIERGFLSSDITNLPEPL 419 ********************************************************************* PP TIGR01890 413 rklynyqrrskilvkk 428 + lyn qr+skil k lcl|NCBI__GCF_000384075.1:WP_029151571.1 420 KALYNPQRNSKILCKD 435 *************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (437 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.69 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory