Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate WP_029151613.1 METMI_RS0110520 aminodeoxychorismate synthase, component I
Query= curated2:P14953 (494 letters) >NCBI__GCF_000384075.1:WP_029151613.1 Length = 465 Score = 261 bits (667), Expect = 4e-74 Identities = 160/460 (34%), Positives = 246/460 (53%), Gaps = 25/460 (5%) Query: 34 SLFKRFEESSCCFLLESVEGGEKWARYSIIGKNPFLVVESYKNKTIIRERNGSQREVEGN 93 +LF + + L+S + RY II P + ++ T I + + + + Sbjct: 19 ALFSAWADQPWAVFLDSGHPSSQQGRYDIIAAEPLCTLVTHGGTTTITSAS-EVIQSQAD 77 Query: 94 PVEIIKGIMGKFKG--ANLPNLPRFNGGAVGYFGYDLIRHYENLPNVPEDDMGLPECHFM 151 P ++K + F G N+ LP FNGGA+GYF YDL R E LP + ED + E Sbjct: 78 PFLLVKQKLQDFAGRAVNISGLP-FNGGAIGYFSYDLARRLEQLPVIAEDAEQIAEMAVG 136 Query: 152 FTDEVLVYDHLKQKIHIIVNLHVNGNIERAYISAVDRIKTI--HREILDTRWKTADNSVL 209 ++ DH +Q+ +V ++ + I+ R+ HR +VL Sbjct: 137 IYHWAVIVDH-QQRQSTLVTQGLDAQACQRLIARFSRLPETQPHRPF----------AVL 185 Query: 210 SYNKKKNELAVTSNISKEDFCRNVLKAKQYIRDGDIFQVVLSQRLCVETNENPFNIYRAL 269 + N+ + + + + KQY+ +GD +QV L+QR +P+ Y+ L Sbjct: 186 G--------EIQPNMDRAYYAQAFQRIKQYLLEGDCYQVNLTQRFSAACVGDPWTAYQLL 237 Query: 270 RVINPSPYMYYLKFGGYRIIGSSPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALEKEL 329 R +N +P+ YL F RI+ SSPE ++++NG VET PI GTR R ED L Sbjct: 238 RQVNAAPFSAYLNFPEVRILSSSPERFLKLQNGKVETKPIKGTRPRKADAAEDAGQITLL 297 Query: 330 LSDEKEIAEHVMLVDLGRNDIGRVSKFGTVAVKNLMHIERYSHVMHVVTNVQGEIREDKT 389 + +K+ AE++M+VDL RNDIG+ K G+V V L +E Y+ V H+V+ V GE+ E + Sbjct: 298 ENSQKDRAENLMIVDLLRNDIGKTCKKGSVKVPKLFAVESYATVHHLVSTVTGELAEGQH 357 Query: 390 PFDALMSILPAGTLSGAPKVRAMEIIDELETVKRGPYGGAIGYLSFNGNLDSCITIRTII 449 D L S P G+++GAPK+R+ME+I+ELE +RG Y G+I Y+ F+GN+DS I IRT++ Sbjct: 358 ALDLLRSCFPGGSITGAPKIRSMEVIEELEPNRRGVYCGSIAYIGFDGNMDSNIAIRTLV 417 Query: 450 LKDGKAYVQAGAGIVADSVPEREYEECYNKAMALLKAIEE 489 AG GIV DSV EY+EC++KA ALL+ +++ Sbjct: 418 QSGETIRFWAGGGIVNDSVLAEEYQECFDKAAALLRVLQQ 457 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 527 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 465 Length adjustment: 34 Effective length of query: 460 Effective length of database: 431 Effective search space: 198260 Effective search space used: 198260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory