Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_029908943.1 P166_RS0103885 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000711315.1:WP_029908943.1 Length = 367 Score = 322 bits (826), Expect = 8e-93 Identities = 170/360 (47%), Positives = 235/360 (65%), Gaps = 3/360 (0%) Query: 2 SEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVL 61 +E ++L +R IDS+D I LI+ RA CAQ+VA KT + VFYRPEREA VL Sbjct: 6 AEKERLLEIRNEIDSIDAEIQTLIARRAECAQQVAHAKTQGGQV--DVVFYRPEREAQVL 63 Query: 62 KHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVIS 121 + + E NK + + EM RLFREIMS CLALEQP+++AYLGPEG++S A+ +K FG S + Sbjct: 64 RAVKERNKSLISDNEMMRLFREIMSVCLALEQPIKIAYLGPEGSYSHASVIKQFGASAHT 123 Query: 122 KPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLL 181 +++I+EVF V G N+G+VPVENS+EGAV T + ++ + + GE+EL IHH + Sbjct: 124 LAVSSIEEVFTAVEKGDANYGLVPVENSSEGAVKQTQQALMKTSLKVTGEIELVIHH-CI 182 Query: 182 VGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAG 241 + + K + I ++ +H Q+L QC WL + P VE AV+SNA AA+ + AIA Sbjct: 183 MSQNEKLENIKKVVAHTQALGQCEHWLKNNMPWVEIEAVASNALAAQMASQDDTLGAIAS 242 Query: 242 DMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLM 301 + AAQLYGL L IED NST+F IGS+E P+GDDKT++IVSM NK GAL ++L Sbjct: 243 EQAAQLYGLRVLESHIEDSHENSTKFWAIGSEETEPSGDDKTAMIVSMSNKSGALMDVLS 302 Query: 302 PFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 F S I +TRI + PS KW Y+FFID +GH ++ + LE++ + K+LGS+P Sbjct: 303 SFASRKISMTRIISVPSTDTKWDYLFFIDILGHKKEASVAEALEEVKQKTSYFKLLGSFP 362 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 367 Length adjustment: 30 Effective length of query: 335 Effective length of database: 337 Effective search space: 112895 Effective search space used: 112895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory