Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_029909039.1 P166_RS0104155 threonine synthase
Query= curated2:O24924 (486 letters) >NCBI__GCF_000711315.1:WP_029909039.1 Length = 491 Score = 405 bits (1041), Expect = e-117 Identities = 225/492 (45%), Positives = 310/492 (63%), Gaps = 12/492 (2%) Query: 1 MPFVPTRSLKEKK---IDFIEAILNPNAPKGGLYT---LERFETLQWQDCLNLSYNDLVE 54 M F+ TR ++ I F +AIL+P + GG+Y+ L F+ + +N Y L + Sbjct: 1 MKFIETRGNDGQRPTHISFAQAILSPMSSFGGIYSPESLPSFDEAFFMSHVNSGYKTLAK 60 Query: 55 CVFERLGLEIPKNLLASALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQ 114 V + ++I + ++ AL Y+ FD+P NP P+ + + LFV ELYHGP+ AFKDMALQ Sbjct: 61 DVLKAFEIDIEEKIIDEALALYDEFDDPSNPVPVVKVYDDLFVSELYHGPTRAFKDMALQ 120 Query: 115 PLASLFSNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQM 174 P + S LA ++EKYL+L +TSGDTGPA LE+ NV V CLYP GTS VQ+LQM Sbjct: 121 PFGKVLSALAQARDEKYLILAATSGDTGPAALETFKNRDNVQVACLYPDGGTSDVQRLQM 180 Query: 175 VTQSASNLKVFGISGDFDDAQNALKNLLKDDDFNEALKACQLKLSVANSVNFGRIAFQIV 234 VT+ A+NLKV GI GDFDDAQ ALK+LL + F +ALK + LS ANSVNFGRI FQ + Sbjct: 181 VTEDAANLKVIGIHGDFDDAQTALKSLLVSEKFRDALKEHNISLSAANSVNFGRIIFQTI 240 Query: 235 YHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIDKIKVVTNSNDVLR 294 YHI+ +LEL ++GAI +++ L +PSGNFGNALG +YA KMGL + +I + +N N+VL Sbjct: 241 YHIYSYLELVRQGAIQMGDQVYLNVPSGNFGNALGGYYALKMGLPVKQIHIASNMNNVLT 300 Query: 295 EFIETGRYDLTHRSLKQTYSPAMDILKSSNVERALFSLFGFERTLELMQALEEEKFYALK 354 +FI TGRYDL S+ T SPAMDILKSSN+ER LF LFG ERT ELM L+ KFY L Sbjct: 301 KFINTGRYDLREISVIPTTSPAMDILKSSNIERVLFDLFGAERTKELMFELDNHKFYELT 360 Query: 355 PKELALLQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTHE----KTLV 410 EL+ +Q F+ C+DE + IQ+ ++ YL+ PHTAT A E KT+ Sbjct: 361 EAELSQVQAIFAADFCTDEEGMNYIQQAFSV-GYLMCPHTATCFKAYDTCREDKTLKTIA 419 Query: 411 SATASYEKFPRITLLALNEQKKNDNDKAALETLKNSYNTPDSQRLDDLFERGIKHQEVLK 470 +TA + KF + AL ++D+ AL+ + + +++ LF + + + V+ Sbjct: 420 YSTAEWTKFSPVIAKALTGD-IYEHDRDALKMIADKAGISIPSQIEALFSKPVAQKTVID 478 Query: 471 LNEIKSSILLWL 482 +I+S IL +L Sbjct: 479 KQDIESEILKFL 490 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 491 Length adjustment: 34 Effective length of query: 452 Effective length of database: 457 Effective search space: 206564 Effective search space used: 206564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate WP_029909039.1 P166_RS0104155 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.20116.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-83 264.1 0.0 1.2e-82 263.7 0.0 1.1 1 lcl|NCBI__GCF_000711315.1:WP_029909039.1 P166_RS0104155 threonine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000711315.1:WP_029909039.1 P166_RS0104155 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 263.7 0.0 1.2e-82 1.2e-82 8 334 .. 66 439 .. 60 444 .. 0.93 Alignments for each domain: == domain 1 score: 263.7 bits; conditional E-value: 1.2e-82 TIGR00260 8 levt.ekdlvdlaegstelfrspklaeevga..enlyvkelfhgPtlaFKDrglqfvavlltkalelgn 73 e+ e++++d a + f+ p ++ +v + +l+v el+hgPt aFKD++lq+ +++l++++++ lcl|NCBI__GCF_000711315.1:WP_029909039.1 66 FEIDiEEKIIDEALALYDEFDDPSNPVPVVKvyDDLFVSELYHGPTRAFKDMALQPFGKVLSALAQARD 134 5666688889999999999****99998888899*******************************9998 PP TIGR00260 74 e..tvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdl 139 e ++l AtsGdtg+aa+e ++ + nv+v +LyP+g++s v ++vt a n+kv++i+GdFDdaq++ lcl|NCBI__GCF_000711315.1:WP_029909039.1 135 EkyLILAATSGDTGPAALETFKNRDNVQVACLYPDGGTSDVqRLQMVTEDAANLKVIGIHGDFDDAQTA 203 888**************************************99************************** PP TIGR00260 140 vkeife.dke........klklnsvNsinparieaqk.tyafeiveqlgk...espdkvvvpvpsgnfg 195 +k+++ + + ++ l+++Ns+n++ri +q +++++ +e + + + d+v + vpsgnfg lcl|NCBI__GCF_000711315.1:WP_029909039.1 204 LKSLLVsE-KfrdalkehNISLSAANSVNFGRIIFQTiYHIYSYLELVRQgaiQMGDQVYLNVPSGNFG 271 ***99844.4488888889*****************99*********99999999************** PP TIGR00260 196 ailkGflekkelglpieklaiaaegaadivrrflksg..dlepkedkeTlstAmdignpsnverale.. 260 ++l G++++k++ lp++ + ia++ + +++++f+++g dl +++ T s+Amdi+++sn+er+l+ lcl|NCBI__GCF_000711315.1:WP_029909039.1 272 NALGGYYALKMG-LPVKQIHIASNMN-NVLTKFINTGryDLREISVIPTTSPAMDILKSSNIERVLFdl 338 ************.************8.*********98566666777*******************999 PP TIGR00260 261 .larrslgnledlke.....................svsdeeileaikklaeeegyllephtavavaal 307 +a+r+++ + +l++ ++dee ++ i+++ + gyl+ phta+ +a lcl|NCBI__GCF_000711315.1:WP_029909039.1 339 fGAERTKELMFELDNhkfyelteaelsqvqaifaadFCTDEEGMNYIQQAF-SVGYLMCPHTATCFKAY 406 999**********99********************99*********99976.67**************9 PP TIGR00260 308 kklvekg.....vsatadpaKFeevve.altgn 334 e+ ++ta+ KF+ v++ altg lcl|NCBI__GCF_000711315.1:WP_029909039.1 407 DTCREDKtlktiAYSTAEWTKFSPVIAkALTGD 439 88887776765566************99**996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (491 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.69 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory