Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_029912185.1 P166_RS0110195 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:A9KNX3 (239 letters) >NCBI__GCF_000711315.1:WP_029912185.1 Length = 257 Score = 128 bits (321), Expect = 1e-34 Identities = 77/230 (33%), Positives = 123/230 (53%), Gaps = 19/230 (8%) Query: 2 RLYPAIDIRNGQCVRLRQGQFHDVEVYSHVPANIAMQWEGQGASYIHIVDLDGALAGHSV 61 R+ P +D+ NG+ V+ QF D+ + P IA +++ QGA I +D+ + Sbjct: 6 RIIPCLDVDNGRVVK--GVQFVDIRDAGN-PVEIAKRYDEQGADEITFLDITATADDRAT 62 Query: 62 NDEVIKEIVQTVSVPIQVGGGIRTIQDIEHKLNLGVNRVIIGTKAVENPQFVKEIISTFG 121 V++E+ V +P+ VGGGIRT++DI LN G ++V I + A+ NP FV+E TFG Sbjct: 63 MVHVVEEVASQVFIPLTVGGGIRTVEDIRRMLNAGADKVAINSAAIFNPAFVQEASDTFG 122 Query: 122 ADKIVIGIDAKNGMVA---------IEGWEKVSNYNAVSLALEMKELGVSTIVYTDISKD 172 + IV+ IDAK +A G + + +A+ A +M+ LG ++ T + +D Sbjct: 123 SQCIVVAIDAKKVSLAGDPDKWEIFTHGGRRETGIDAIEWAKKMEALGAGELLVTSMDRD 182 Query: 173 GMLQGPNIEHTKEMVDLTGLNIIASGGVSSMKDLEELDKIKVSGVIIGKA 222 G G ++E T+ + D + +IASGGV +K L E GV+ G A Sbjct: 183 GTKIGFDLELTRNIADSVNIPVIASGGVGELKHLTE-------GVVSGHA 225 Lambda K H 0.317 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 257 Length adjustment: 24 Effective length of query: 215 Effective length of database: 233 Effective search space: 50095 Effective search space used: 50095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory