Align branched-chain amino acid aminotransferase subunit (EC 2.6.1.6; EC 2.6.1.42) (characterized)
to candidate WP_029912885.1 P166_RS0111540 cytochrome c550
Query= metacyc::MONOMER-11904 (286 letters) >NCBI__GCF_000711315.1:WP_029912885.1 Length = 289 Score = 164 bits (415), Expect = 2e-45 Identities = 92/280 (32%), Positives = 160/280 (57%), Gaps = 10/280 (3%) Query: 4 YLNGEFVEKEQAKISVYDHGLLYGDGVFEGIRVYDGVIFKLKEHIDRLFDSATSLQMDIQ 63 +LNG+F+ E+AKIS D G L+GDG++E I V+ +F+L H+DRL S T++ M Sbjct: 7 FLNGDFLPLEEAKISTQDRGFLFGDGIYEVIPVFQKKLFQLDAHLDRLRKSLTAISMQDP 66 Query: 64 TSKDEISKIVIDTIRINELNNAYIRLVITRGVGDL-GLDPRKCPKPTIFCIAEPMNPL-- 120 S ++ ++ D + + N+ +I L +TRG+ + P K PTI+ P+ P+ Sbjct: 67 YSDEQWKALLNDLVNRHPWNDQFIYLQVTRGIQWVRDHTPDKDLTPTIYAYCNPLKPVSE 126 Query: 121 -LGEDGIKVIT-SSIRRLPVDVLNPAVKSLNYLNSILAKIQANYAGCDEAFLLDSEGYVA 178 + ++GIK++T IR L D+ K+ L +++ KI A G D+A L+ +G ++ Sbjct: 127 SILQNGIKIVTLEDIRWLRCDI-----KATTLLPNVMMKIAAKEQGADDAILIGRDGQIS 181 Query: 179 EGTGDNIFVIKNGKIKTPPVSSSVLKGITRDAVVDLAKEQGYEIIEEKLTLHDLYVADEL 238 EGT N+F++K+ + TPP+S +L GITR + +A + ++IE+ LTL DL ADE+ Sbjct: 182 EGTASNVFIVKDEVLLTPPLSDRILPGITRMIIEKIANDHSIKVIEQTLTLADLEAADEI 241 Query: 239 FITGTAAELAHVVEIDGRVINNREMGVITKKLSEEFKKIR 278 ++T + + V ++ + + + G I K+ F + + Sbjct: 242 WLTSSTKDALPVCLLNNAPVGSGKPGPIWLKMQSYFAQAK 281 Lambda K H 0.319 0.140 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 289 Length adjustment: 26 Effective length of query: 260 Effective length of database: 263 Effective search space: 68380 Effective search space used: 68380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory