Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_029934734.1 N746_RS0105770 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000711195.1:WP_029934734.1 Length = 292 Score = 247 bits (630), Expect = 3e-70 Identities = 125/280 (44%), Positives = 176/280 (62%) Query: 3 KKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQG 62 +++ + GVGLIGGSFAL L++ G IVG G +++LE+A LG+ID TD AV+ Sbjct: 4 ERLCVIGVGLIGGSFALKLKQLGLVDEIVGYGHRVENLEKAVALGVIDRYETDVTFAVKD 63 Query: 63 ADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAHP 122 ADL++++ P+ G + A I PHL P+ IVTDAGS K V+ LGD F+P HP Sbjct: 64 ADLVVLSVPLGAIGSLFAEIVPHLNPKTIVTDAGSAKDSVIKDIVEKLGDCPPNFVPGHP 123 Query: 123 IAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDAV 182 IAGREK G EA A+LY+ +V++T + VE+V + W + GA + ++P HD V Sbjct: 124 IAGREKSGVEAVEADLYQNHRVILTPTETTSESAVELVKSLWTSVGANVSLMAPAFHDEV 183 Query: 183 FASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRDA 242 FA+ SHLPH+LAFALVD + +FQY A GFRDFTRIA+S MWRDI L N A Sbjct: 184 FAATSHLPHMLAFALVDMLNEHAELGNVFQYTAGGFRDFTRIASSDATMWRDIALHNSTA 243 Query: 243 LLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQ 282 L+ ++ Y +L+ + +I + +GP + ++ A+ AR Q Sbjct: 244 LVKWLNEYQAELKQLTQLIESKNGPALFTLFDQAKAARDQ 283 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 292 Length adjustment: 26 Effective length of query: 269 Effective length of database: 266 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory