Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_029935993.1 N746_RS0109310 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000711195.1:WP_029935993.1 Length = 347 Score = 480 bits (1235), Expect = e-140 Identities = 234/344 (68%), Positives = 276/344 (80%) Query: 45 IKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEPD 104 I+VGIVGGTGYTGVELLR+LA HP V ITSRSEAGM VAEM+PNLRGHYDLAFSEPD Sbjct: 4 IQVGIVGGTGYTGVELLRLLANHPHAEVKVITSRSEAGMKVAEMFPNLRGHYDLAFSEPD 63 Query: 105 VNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESPE 164 ++ L +CDLVFFATPHGVAM + PEL+ AGVRV+DL+ADFRL DL VW NWYGMAH PE Sbjct: 64 MSTLTSCDLVFFATPHGVAMSLTPELVQAGVRVIDLAADFRLNDLQVWENWYGMAHTCPE 123 Query: 165 WAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSGAS 224 ++ VYGLPE R++I+ A+++ANPGCYPTAVQLGF PLL+ GLVD LIAD KSG S Sbjct: 124 IMDEVVYGLPEFNREKIKTAKVIANPGCYPTAVQLGFQPLLKAGLVDIDHLIADGKSGVS 183 Query: 225 GAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIRGI 284 GAGR K+G L E E FKAYG +GHRHLPEI +GL AG V +TFVPHL+PMIRGI Sbjct: 184 GAGRGAKVGSLSAETSEGFKAYGINGHRHLPEIAEGLNHMAGSRVNLTFVPHLVPMIRGI 243 Query: 285 EATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQEQ 344 EATLY +L ++LQ LFE+ + EPFVDVMP GS P+TR V+G+N CRMA++R Sbjct: 244 EATLYGKLNQDWSQEQLQELFEKHYAQEPFVDVMPAGSLPDTRMVKGSNMCRMAVYRPAG 303 Query: 345 SNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 ++V+V+SVIDNLVKGA+GQAVQNMN+MFGL+ET GLE AL+P Sbjct: 304 GDVVVVTSVIDNLVKGASGQAVQNMNLMFGLEETCGLEQVALMP 347 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 347 Length adjustment: 30 Effective length of query: 358 Effective length of database: 317 Effective search space: 113486 Effective search space used: 113486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_029935993.1 N746_RS0109310 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.14608.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-137 444.5 0.0 1.5e-137 444.3 0.0 1.0 1 lcl|NCBI__GCF_000711195.1:WP_029935993.1 N746_RS0109310 N-acetyl-gamma-gl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000711195.1:WP_029935993.1 N746_RS0109310 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.3 0.0 1.5e-137 1.5e-137 1 345 [] 4 347 .] 4 347 .] 0.98 Alignments for each domain: == domain 1 score: 444.3 bits; conditional E-value: 1.5e-137 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileead 69 i+v+ivG++GYtG+eLlrlla+Hp++ev+ ++s++eag k++e++p+l+g++dl ++e ++++ l+++d lcl|NCBI__GCF_000711195.1:WP_029935993.1 4 IQVGIVGGTGYTGVELLRLLANHPHAEVKVITSRSEAGMKVAEMFPNLRGHYDLAFSEPDMST-LTSCD 71 68***************************8888888*********************999985.569** PP TIGR01850 70 vvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreei 138 +vf+A+phgv+++l pel+++gv+vidl+adfRl+d +v+e+wYg+ h+ +e+++e+vYGlpE+nre+i lcl|NCBI__GCF_000711195.1:WP_029935993.1 72 LVFFATPHGVAMSLTPELVQAGVRVIDLAADFRLNDLQVWENWYGMAHTCPEIMDEVVYGLPEFNREKI 140 ********************************************************************* PP TIGR01850 139 kkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvtk 207 k+ak+ianPGCy+Ta++L+ Pllk++l++ +++i d+ksGvSgAGr a+ sl ae++e +k+Y +++ lcl|NCBI__GCF_000711195.1:WP_029935993.1 141 KTAKVIANPGCYPTAVQLGFQPLLKAGLVDIDHLIADGKSGVSGAGRGAKVGSLSAETSEGFKAYGING 209 ********************************************************************* PP TIGR01850 208 HrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlk 276 HrH pEi++ l+++a+++v+++f+phlvpm+rGi at+y kl++++++e+l++l+e+ Y++epfv+v++ lcl|NCBI__GCF_000711195.1:WP_029935993.1 210 HRHLPEIAEGLNHMAGSRVNLTFVPHLVPMIRGIEATLYGKLNQDWSQEQLQELFEKHYAQEPFVDVMP 278 ********************************************************************* PP TIGR01850 277 egelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +g+lP+t+ v gsn+++++v + vvv+s+iDNLvKGa+gqAvqn+Nlm+g++et gLe+++l+p lcl|NCBI__GCF_000711195.1:WP_029935993.1 279 AGSLPDTRMVKGSNMCRMAVYRPAGGDVVVVTSVIDNLVKGASGQAVQNMNLMFGLEETCGLEQVALMP 347 *****************************************************************9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (347 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.63 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory