Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_029936184.1 N746_RS0109865 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >NCBI__GCF_000711195.1:WP_029936184.1 Length = 339 Score = 326 bits (835), Expect = 6e-94 Identities = 167/337 (49%), Positives = 230/337 (68%) Query: 3 ITPQQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAAT 62 +T +AL R ++ + EM +M+ +M GE +DA + +L LR+K ETI EIA AA Sbjct: 1 MTLSEALTRLLKRENLNGSEMQSVMQTLMSGEATDAQIGGLLMALRMKGETIEEIAAAAQ 60 Query: 63 VMREFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKS 122 VMR S RVE+ DR H+VD GTGGDG++ FN+ST FVA+A GA+VAKHGNRSVSSKS Sbjct: 61 VMRNLSTRVELDDRSHLVDTCGTGGDGANIFNVSTATAFVASAAGARVAKHGNRSVSSKS 120 Query: 123 GSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNIL 182 GSAD LEA G + L QVAA + Q G+GFM+AP HH AMK V R+E+GVRTIFN+L Sbjct: 121 GSADVLEAAGVNLNLSVNQVAACVEQVGVGFMFAPAHHGAMKHVVAARKELGVRTIFNVL 180 Query: 183 GPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGEL 242 GPLTNPA +P ++GV+ DL+ A VL++LG+E +VV DG+DE+S+ T V EL Sbjct: 181 GPLTNPAQAPYQVLGVYDRDLLVPFAEVLKQLGSEHVMVVHAEDGLDEISVTCPTHVAEL 240 Query: 243 RDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGAAL 302 ++GQ+ E+ + P+++ + + L V A +S ++ +N G A DI+ LNAGAAL Sbjct: 241 KNGQIREWTIDPQEYDMDHVSLEGLAVDSAQQSLNIIRAAFNNSDGAAKDIICLNAGAAL 300 Query: 303 YVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQ 339 YVAG+++S A+G++ AR +A G A+ LD ++ FTQ Sbjct: 301 YVAGISNSFAEGVLLARGAIAQGLAQQKLDQFIQFTQ 337 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 339 Length adjustment: 29 Effective length of query: 316 Effective length of database: 310 Effective search space: 97960 Effective search space used: 97960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_029936184.1 N746_RS0109865 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.24585.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-132 425.5 4.6 9e-132 425.3 4.6 1.0 1 lcl|NCBI__GCF_000711195.1:WP_029936184.1 N746_RS0109865 anthranilate phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000711195.1:WP_029936184.1 N746_RS0109865 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 425.3 4.6 9e-132 9e-132 2 329 .. 8 334 .. 7 335 .. 0.99 Alignments for each domain: == domain 1 score: 425.3 bits; conditional E-value: 9e-132 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeesee 70 +ll++++L+ e++++m+++msgea+daqi+ +l+alr+kget+eeia++a+++r+ +++ve +++++ lcl|NCBI__GCF_000711195.1:WP_029936184.1 8 TRLLKRENLNGSEMQSVMQTLMSGEATDAQIGGLLMALRMKGETIEEIAAAAQVMRNLSTRVELDDRSH 76 6899***************************************************************** PP TIGR01245 71 lvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsle 139 lvD++GTGGDg++ +N+STa+a+va+aaG++vaKhGnrsvssksGsaDvLea gvnl+ls ++va+++e lcl|NCBI__GCF_000711195.1:WP_029936184.1 77 LVDTCGTGGDGANIFNVSTATAFVASAAGARVAKHGNRSVSSKSGSADVLEAAGVNLNLSVNQVAACVE 145 ********************************************************************* PP TIGR01245 140 evgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgv 208 +vg+gF+fAP++h a+k+v++ RkeLgvrt+fN+LGPL+nPa+a++qvlGvy++dl+ +aevlk+lg+ lcl|NCBI__GCF_000711195.1:WP_029936184.1 146 QVGVGFMFAPAHHGAMKHVVAARKELGVRTIFNVLGPLTNPAQAPYQVLGVYDRDLLVPFAEVLKQLGS 214 ********************************************************************* PP TIGR01245 209 kralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevleg 277 ++++vvh+edglDEis+t +t+vaelk+g+i+e t++p+++++++ +le l+++sa+++++++++++++ lcl|NCBI__GCF_000711195.1:WP_029936184.1 215 EHVMVVHAEDGLDEISVTCPTHVAELKNGQIREWTIDPQEYDMDHVSLEGLAVDSAQQSLNIIRAAFNN 283 ****************************************************************99998 PP TIGR01245 278 kekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 +a++di+ lNa+aalyvag ++++egv la+ ai +g a +kl+++++ lcl|NCBI__GCF_000711195.1:WP_029936184.1 284 SD-GAAKDIICLNAGAALYVAGISNSFAEGVLLARGAIAQGLAQQKLDQFIQ 334 87.999******************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory