Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_034991565.1 DL88_RS03205 succinyl-diaminopimelate desuccinylase
Query= BRENDA::P44514 (377 letters) >NCBI__GCF_000745425.1:WP_034991565.1 Length = 388 Score = 290 bits (742), Expect = 5e-83 Identities = 161/385 (41%), Positives = 237/385 (61%), Gaps = 11/385 (2%) Query: 1 MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTL-----NLWAKH 55 M++ + LA+ LI PS++P D G I+ RL++ GF+ + F D NL+A+ Sbjct: 4 MQDNALDLARALIACPSVTPQDGGALGILENRLKQAGFRTHRLTFQDEGTPDIDNLYARF 63 Query: 56 GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115 GT P +AFAGHTDVVP G + W PF+ +I DG ++GRGAADMKG++AA +AA ++ Sbjct: 64 GTKGPCLAFAGHTDVVPVGSASDWRFDPFAGKIEDGQIWGRGAADMKGAIAAFAIAAMDF 123 Query: 116 VKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175 V + + +G+IA LIT DEE + +GTI ++ + E +C+VGEP++ + LGD++K Sbjct: 124 VTTH-SFEGSIAFLITGDEEGPSINGTIKLLHWATEQGEHFDHCIVGEPTNPQQLGDMIK 182 Query: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIA 235 GRRGS+ G L +QG QGHVAYP A+NPI + L D+G F ++L++ Sbjct: 183 IGRRGSLNGTLRVQGKQGHVAYPQRADNPIPTLIRLIAALKV-PLDEGTAHFDASNLEVV 241 Query: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEK--HNLKYRIEWNLSGKP 293 + +GTG+ NVIPA+ +FN+R+ T E ++Q++A +EK N Y + + P Sbjct: 242 ALTSGTGAYNVIPAQAEAKFNIRFNDLWTAETLRQELATRIEKVAENAAYTLTFEPCNAP 301 Query: 294 -FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVN 352 FLTKP + + SAIE+ G P+ T GGTSD RFI+ VVEFG + T+H V+ Sbjct: 302 AFLTKPDPFTELVASAIEKGTGRRPELSTTGGTSDARFISAY-CPVVEFGLVGQTMHMVD 360 Query: 353 ECVSVEDLGKCGEIYHKMLVNLLDS 377 E VSV+D+ + EIY +LV+ DS Sbjct: 361 ERVSVDDITRLKEIYESILVDYFDS 385 Lambda K H 0.316 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 388 Length adjustment: 30 Effective length of query: 347 Effective length of database: 358 Effective search space: 124226 Effective search space used: 124226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_034991565.1 DL88_RS03205 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.29956.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-129 417.7 0.0 2.4e-129 417.5 0.0 1.0 1 lcl|NCBI__GCF_000745425.1:WP_034991565.1 DL88_RS03205 succinyl-diaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745425.1:WP_034991565.1 DL88_RS03205 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.5 0.0 2.4e-129 2.4e-129 2 368 .. 9 380 .. 8 382 .. 0.96 Alignments for each domain: == domain 1 score: 417.5 bits; conditional E-value: 2.4e-129 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefed.....tknlwatrgteepvlvfaGhtD 65 l+la+ Li +svtP+d ga+ ++++rLk+ gf++++l+f+d + nl+a+ gt+ p l+faGhtD lcl|NCBI__GCF_000745425.1:WP_034991565.1 9 LDLARALIACPSVTPQDGGALGILENRLKQAGFRTHRLTFQDegtpdIDNLYARFGTKGPCLAFAGHTD 77 6899**********************************99853333379******************** PP TIGR01246 66 vvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegea 134 vvP+G+ ++W+ dpf+ +++dG+++grGaaDmkg++aaf +aa +fv+ + ++Gs+++lit Deeg + lcl|NCBI__GCF_000745425.1:WP_034991565.1 78 VVPVGSASDWRFDPFAGKIEDGQIWGRGAADMKGAIAAFAIAAMDFVTTH-SFEGSIAFLITGDEEGPS 145 ***********************************************998.5***************** PP TIGR01246 135 idGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhk 203 i+Gt+k++++ +e+ e+ d+++vgeP+ ++lGD+ikiGrrGs++g+l+++G+qGhvaYP++a+nP+++ lcl|NCBI__GCF_000745425.1:WP_034991565.1 146 INGTIKLLHWATEQGEHFDHCIVGEPTNPQQLGDMIKIGRRGSLNGTLRVQGKQGHVAYPQRADNPIPT 214 ********************************************************************* PP TIGR01246 204 avpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekil 272 +++++++l ++ lDeG+++f +s+l++ +++gtga nviP+++++kfn+rf+ +++e+l++++++ + lcl|NCBI__GCF_000745425.1:WP_034991565.1 215 LIRLIAAL-KVPLDEGTAHFDASNLEVVALTSGTGAYNVIPAQAEAKFNIRFNDLWTAETLRQELATRI 282 ****9998.689****************************************************99999 PP TIGR01246 273 dkh..kldYelewk.lsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelG 338 +k + Y+l ++ + + +fltk + ++ va+aie+ ++++pelst+GGtsDarfi ++ + vve+G lcl|NCBI__GCF_000745425.1:WP_034991565.1 283 EKVaeNAAYTLTFEpCNAPAFLTKPDPFTELVASAIEKGTGRRPELSTTGGTSDARFISAY-CPVVEFG 350 98656899*****8456788*****************************************.******* PP TIGR01246 339 lvndtihkvneavkiedleklsevyeklle 368 lv +t+h v+e+v+++d+ +l+e+ye++l lcl|NCBI__GCF_000745425.1:WP_034991565.1 351 LVGQTMHMVDERVSVDDITRLKEIYESILV 380 ***************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory