GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroL in Beijerinckia mobilis UQM 1969

Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_034991895.1 DL88_RS04020 Holliday junction branch migration DNA helicase RuvB

Query= curated2:A4FBE7
         (175 letters)



>NCBI__GCF_000745425.1:WP_034991895.1
          Length = 354

 Score = 45.4 bits (106), Expect = 1e-09
 Identities = 39/123 (31%), Positives = 54/123 (43%), Gaps = 22/123 (17%)

Query: 8   VGPPGAGKTTVGRLLAERLGVAFRDTDDDVVRVAGKPIAEIFTGDGEPVFRAMEERAVAA 67
           VGPPG GKTT+ +++A  LGV FR T   V+  AG   A++          A+E+R    
Sbjct: 65  VGPPGLGKTTLAQIVARELGVNFRSTSGPVIAKAGDLAAQL---------TALEDR---- 111

Query: 68  ALAEHDGVLSLGGGSVLSERTRALL---AEQPVVFLSVGLAEGARRTGLSTARPLLAGVN 124
                  VL +     L+     +L    E   + L +G   GAR   +  AR  L G  
Sbjct: 112 ------DVLFIDEIHRLNPAVEEILYPAMEDFQLDLIIGEGPGARSVKIDLARFTLVGAT 165

Query: 125 PRA 127
            RA
Sbjct: 166 TRA 168


Lambda     K      H
   0.318    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 158
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 175
Length of database: 354
Length adjustment: 24
Effective length of query: 151
Effective length of database: 330
Effective search space:    49830
Effective search space used:    49830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory