Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_034992943.1 DL88_RS04220 ornithine--oxo-acid transaminase
Query= SwissProt::P38021 (401 letters) >NCBI__GCF_000745425.1:WP_034992943.1 Length = 414 Score = 411 bits (1057), Expect = e-119 Identities = 204/394 (51%), Positives = 268/394 (68%), Gaps = 3/394 (0%) Query: 8 KEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQA 67 +++I YGA+NY PLP+V++ GA + D EG Y+DM+SAYSA + GH HP+++ A Sbjct: 2 QDVIGLEERYGAHNYAPLPVVLTHGRGACLFDEEGRRYIDMMSAYSAASFGHLHPRLVAA 61 Query: 68 LKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEV 127 LK Q D++ L SRAFH D LGPF E A LTG + LPMNTGAEAVE+A+KAARR+ Y+ Sbjct: 62 LKRQLDRVDLVSRAFHTDGLGPFCEDLAGLTGLDACLPMNTGAEAVETAIKAARRYGYDR 121 Query: 128 KGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAIT 187 + ++AEII GNFHGRT + SS+ +RGFGP PG ++P+GD AL A+ Sbjct: 122 LSIPHDKAEIIVAAGNFHGRTTTIIGFSSDAATRRGFGPFAPGFVMVPFGDTGALEAAVG 181 Query: 188 PNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWD 247 P TAA L EPIQGEAGIV+PP G+L +C +L I DEIQ+G GRTG+TFA + + Sbjct: 182 PCTAAVLIEPIQGEAGIVLPPPGYLSAVRRLCDRHGILLILDEIQSGFGRTGRTFAFEHE 241 Query: 248 GIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLE 307 PD ILGKALGGG+ P+S A R ++ VF+PGSHGSTFGGNPLA AV+ ++ VL Sbjct: 242 DAKPDGIILGKALGGGLLPVSAFVARRALMDVFDPGSHGSTFGGNPLAMAVAREAMRVLR 301 Query: 308 DEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEA---ARPYCERLKEEGL 364 +EKL +RS LG L +ID P I+ VRG+GL+ GV+L A A+ C ++ E G+ Sbjct: 302 EEKLPERSARLGTILLDALRAIDHPAIRAVRGKGLWAGVDLDPALINAKDVCMKMLEGGV 361 Query: 365 LCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVL 398 L KETH T IRFAPPL+I+++DL A+ + L Sbjct: 362 LTKETHATTIRFAPPLVIAEDDLLAAVRVFREAL 395 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 414 Length adjustment: 31 Effective length of query: 370 Effective length of database: 383 Effective search space: 141710 Effective search space used: 141710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_034992943.1 DL88_RS04220 (ornithine--oxo-acid transaminase)
to HMM TIGR01885 (rocD: ornithine--oxo-acid transaminase (EC 2.6.1.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01885.hmm # target sequence database: /tmp/gapView.12280.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01885 [M=402] Accession: TIGR01885 Description: Orn_aminotrans: ornithine--oxo-acid transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-150 487.9 0.0 1.1e-150 487.7 0.0 1.0 1 lcl|NCBI__GCF_000745425.1:WP_034992943.1 DL88_RS04220 ornithine--oxo-acid Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745425.1:WP_034992943.1 DL88_RS04220 ornithine--oxo-acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 487.7 0.0 1.1e-150 1.1e-150 2 401 .. 2 395 .. 1 396 [. 0.99 Alignments for each domain: == domain 1 score: 487.7 bits; conditional E-value: 1.1e-150 TIGR01885 2 eevieleekygahnyhplpvvlskaeGakvwdvegkryldflsaysavnqGhchpkivkalveqaqklt 70 ++vi lee+ygahny plpvvl++++Ga ++d eg+ry+d++saysa + Gh hp++v+al+ q +++ lcl|NCBI__GCF_000745425.1:WP_034992943.1 2 QDVIGLEERYGAHNYAPLPVVLTHGRGACLFDEEGRRYIDMMSAYSAASFGHLHPRLVAALKRQLDRVD 70 68999**************************************************************** PP TIGR01885 71 lssrafyndvfgefaeyvtklfGydkvlpmntGaeavetaiklarkWgykkkkipedkalilsaegnfh 139 l sraf++d +g f e ++ l G d +lpmntGaeavetaik ar++gy++ ip+dka i++a+gnfh lcl|NCBI__GCF_000745425.1:WP_034992943.1 71 LVSRAFHTDGLGPFCEDLAGLTGLDACLPMNTGAEAVETAIKAARRYGYDRLSIPHDKAEIIVAAGNFH 139 ********************************************************************* PP TIGR01885 140 GrtlavislstdpesrenfGpyvpnvkkieynnlealeealeeagekvaaflvePiqGeaGvvvpddgy 208 Grt ++i s+d +r++fGp++p++ ++++++ ale a+ + aa+l+ePiqGeaG+v+p gy lcl|NCBI__GCF_000745425.1:WP_034992943.1 140 GRTTTIIGFSSDAATRRGFGPFAPGFVMVPFGDTGALEAAVG---PCTAAVLIEPIQGEAGIVLPPPGY 205 **************************************9875...699********************* PP TIGR01885 209 lkkvrelckkynvlliadeiqtGiartGkllaveheevkPdivllGkalsgGvyPvsavladkevmlti 277 l vr lc+++ +lli deiq G +rtG+ +a+ehe+ kPd ++lGkal+gG++Pvsa +a++++m ++ lcl|NCBI__GCF_000745425.1:WP_034992943.1 206 LSAVRRLCDRHGILLILDEIQSGFGRTGRTFAFEHEDAKPDGIILGKALGGGLLPVSAFVARRALMDVF 274 ********************************************************************* PP TIGR01885 278 kpgehGstygGnPlasavavaalevlkeeklaeraeklGeelreelkklkkeivkevrGkGllnaivid 346 +pg+hGst+gGnPla ava +a++vl+eekl er+++lG++l ++l+++ ++ ++ vrGkGl +++ +d lcl|NCBI__GCF_000745425.1:WP_034992943.1 275 DPGSHGSTFGGNPLAMAVAREAMRVLREEKLPERSARLGTILLDALRAIDHPAIRAVRGKGLWAGVDLD 343 ********************************************************************* PP TIGR01885 347 eskangreawdlclklkekGllakptheeiirlaPPlviteeelkeaveiikkvl 401 + +a d+c+k+ e G+l+k+th + ir+aPPlvi+e++l +av++++++l lcl|NCBI__GCF_000745425.1:WP_034992943.1 344 PAL---INAKDVCMKMLEGGVLTKETHATTIRFAPPLVIAEDDLLAAVRVFREAL 395 **9...7899*****************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (402 nodes) Target sequences: 1 (414 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory