Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_034999399.1 DL88_RS18190 NAD(P)-dependent oxidoreductase
Query= BRENDA::O58256 (333 letters) >NCBI__GCF_000745425.1:WP_034999399.1 Length = 235 Score = 125 bits (314), Expect = 1e-33 Identities = 81/239 (33%), Positives = 133/239 (55%), Gaps = 12/239 (5%) Query: 1 MRPKVGVLLKMKREALEELKKYADVEII----LYPSGEELKGVIGRFDGIIVSPTTKITR 56 M PKV + ++ E + +L +A + +P E+L + ++ I Sbjct: 1 MLPKVVITHRVHEEIISKLSPHARLVCNDTDDTWPR-EKLLAELSDAKAMMAFMPDMIDA 59 Query: 57 EVLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINLMRKI 116 VL +A L++++C G+DN D+E T+RG++VT VS LL++ AE T+GL+I L R I Sbjct: 60 SVLAHAPDLQLVACALKGFDNFDIEACTQRGVHVTIVSDLLTDPTAELTIGLMIALGRHI 119 Query: 117 HYADKFIRRGEWESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRLIPFGVKLYYWS 176 DK +RR +++ + G L G +GILGMGAIGKAIA+RL FG + YW Sbjct: 120 LPGDKSVRR-DYKGWRPRFYGL----GLQGTAIGILGMGAIGKAIAQRLSTFGAIVSYWD 174 Query: 177 RHRKVNVEK-ELKARYMDIDELLEKSDIVILALPLTRDTYHIINEERVKKL-EGKYLVN 233 R ++ L + ++ D+L+ S ++ ALPL+ +T H++ E++ K+ +G L+N Sbjct: 175 RQSLDKADEIRLNVKPLEFDQLISSSTFLVCALPLSAETKHLLGAEQLAKMPKGALLIN 233 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 235 Length adjustment: 26 Effective length of query: 307 Effective length of database: 209 Effective search space: 64163 Effective search space used: 64163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory