Align L-aspartate semialdehyde sulfurtransferase iron-sulfur subunit (characterized)
to candidate WP_035235860.1 Q366_RS01985 sulfite reductase
Query= SwissProt::Q8TPT3 (130 letters) >NCBI__GCF_000745975.1:WP_035235860.1 Length = 267 Score = 48.1 bits (113), Expect = 9e-11 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Query: 64 GAIVAILDRPIHRDEEECVECGACISVCPMNVYSFDETWSLCVDEKKCIQCGMCIKMCPH 123 G I A+ R +E C+ C AC++VC + T ++ + C+ CG C++ CP Sbjct: 133 GIIAAMYPRT---EETLCIGCLACVNVCKEKAVALSNTPFPLINTRACLGCGACVRSCPA 189 Query: 124 GALKLGE 130 G L GE Sbjct: 190 GCLLSGE 196 Lambda K H 0.324 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 130 Length of database: 267 Length adjustment: 19 Effective length of query: 111 Effective length of database: 248 Effective search space: 27528 Effective search space used: 27528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory