Align Homocysteine formation from aspartate semialdehyde (NIL/ferredoxin component) (characterized)
to candidate WP_035236918.1 Q366_RS05035 NIL domain-containing protein
Query= reanno::Miya:8499492 (147 letters) >NCBI__GCF_000745975.1:WP_035236918.1 Length = 143 Score = 131 bits (329), Expect = 5e-36 Identities = 64/137 (46%), Positives = 89/137 (64%), Gaps = 1/137 (0%) Query: 9 YRKNIHLTFPPEISGKPIVSDLVRRYDLTVNILKAQITPRKEGYLTLEISG-GEDNCLKG 67 Y K + L FPP+ + +PIV +LV++YDL NILKA+I+ R EG+L LEIS G+ KG Sbjct: 2 YSKIVILDFPPQSAQRPIVCELVKKYDLMFNILKARISSRSEGHLVLEISSAGKSAFNKG 61 Query: 68 IAYLREQDVTVTDVSQRISRDEDSCMHCGMCTAICPTSALAMDIEARVVVFDKDRCTACG 127 I YL+EQ V V+ +I +DE+ C HCG CTA+CPT AL + V+FD+++C+ C Sbjct: 62 ITYLKEQGVRVSTPEHKIYKDEEICTHCGACTAVCPTGALYIKRPEMEVIFDREKCSLCE 121 Query: 128 LCTRVCPVGAMNVEVEN 144 C CP AM + E+ Sbjct: 122 RCLLTCPTRAMGLFSED 138 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 113 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 147 Length of database: 143 Length adjustment: 16 Effective length of query: 131 Effective length of database: 127 Effective search space: 16637 Effective search space used: 16637 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory