Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_035237791.1 Q366_RS07615 LL-diaminopimelate aminotransferase
Query= BRENDA::O26158 (410 letters) >NCBI__GCF_000745975.1:WP_035237791.1 Length = 408 Score = 520 bits (1338), Expect = e-152 Identities = 246/408 (60%), Positives = 314/408 (76%), Gaps = 2/408 (0%) Query: 1 MVTVNENYLLLKSSYIFSEINRRVEEFQRKNPDADIIRMGIGDVTRPLPEAVVEAFHRAV 60 M+T NENY L +SY+F++I +RV+ +Q NPD ++IR+GIGDVT PLP AVV+ F + V Sbjct: 1 MITANENYNKLNASYLFADIAKRVQLYQDSNPDKEVIRLGIGDVTLPLPPAVVQGFQKGV 60 Query: 61 DEMAEEETFRGYGPEQGYPFLREAIAENDYASRGVDITADEIFISDGAKCDTGNIQEIFG 120 DEM+ + TFRGYGPEQGY FLR+AIA D+ SRG DI ADEIF+SDGAKCDTGN QE+F Sbjct: 61 DEMSADATFRGYGPEQGYLFLRQAIAAGDFQSRGADIEADEIFVSDGAKCDTGNFQELFS 120 Query: 121 LDNVVAVTDPVYPVYVESNVMAGRAGPADDDGRYSGLVYLPCTEENSFIPSLPEERVDLI 180 + +A+ DPVYPVY+++NVMAGR G D GRY G+VY+ C +EN F+P LP+ VDLI Sbjct: 121 NNITIAIPDPVYPVYLDTNVMAGRTGEFKD-GRYQGIVYMDCLKENGFMPDLPDAPVDLI 179 Query: 181 YLCYPNNPTGTTLTEKQLAEWVDYARDSGSLILFDAAYEAYIQEDGIPHSIYEVEGAREV 240 YLC+PNNPTG+T T QLA WV+YARD+ +LILFDAAYEA+I++ +P SIYE+ GA+EV Sbjct: 180 YLCFPNNPTGSTATRDQLAAWVNYARDNKALILFDAAYEAFIRDTDLPRSIYEIPGAKEV 239 Query: 241 AIEFRSFSKNAGFTGTRCAFTVVPEELEVPDSSGRMHSVRELWNRRQTTKFNGVSYPVQR 300 A+EFRSFSK AGFTGTRC FTVVP+ + +SG S+ +WNRRQ+TKFNGVSYPVQ+ Sbjct: 240 AVEFRSFSKTAGFTGTRCGFTVVPKSCMIYTASGSKVSLHNMWNRRQSTKFNGVSYPVQK 299 Query: 301 AAEAVYTPEGQREIRESIDYYMENARIIRESLERAGLRYYGGVNAPYIWIRTPEGMDSWQ 360 AAEAVY+P GQ +I+ +IDYY+ NA+++ +++ G + GG NAPYIWI G DSW+ Sbjct: 300 AAEAVYSPGGQAQIKANIDYYLANAQVVCQTMTDLGFDHVGGKNAPYIWI-DGNGRDSWE 358 Query: 361 FFDTLLNDAEVVGTPGSGFGPSGEGYFRLTAFNSFRNTVKAMERISEL 408 FFD LL+ A VV TPG GFG G Y R++AFNS N KAM R+ ++ Sbjct: 359 FFDLLLDKAGVVCTPGQGFGRCGAQYIRISAFNSPENVAKAMARVKDV 406 Lambda K H 0.317 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 576 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 408 Length adjustment: 31 Effective length of query: 379 Effective length of database: 377 Effective search space: 142883 Effective search space used: 142883 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_035237791.1 Q366_RS07615 (LL-diaminopimelate aminotransferase)
to HMM TIGR03542 (LL-diaminopimelate aminotransferase (EC 2.6.1.83))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03542.hmm # target sequence database: /tmp/gapView.12614.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03542 [M=402] Accession: TIGR03542 Description: DAPAT_plant: LL-diaminopimelate aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-176 572.4 0.0 2.8e-176 572.2 0.0 1.0 1 lcl|NCBI__GCF_000745975.1:WP_035237791.1 Q366_RS07615 LL-diaminopimelate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745975.1:WP_035237791.1 Q366_RS07615 LL-diaminopimelate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 572.2 0.0 2.8e-176 2.8e-176 2 400 .. 3 405 .. 2 407 .. 0.98 Alignments for each domain: == domain 1 score: 572.2 bits; conditional E-value: 2.8e-176 TIGR03542 2 kvnehflklkssylfseiakkvkefrkknpeadiirlgiGdvtqPlakaviealkeaveelaseetfrG 70 + ne+++kl++sylf++iak+v+ ++ +np++++irlgiGdvt Pl++av++ +++ v+e++ + tfrG lcl|NCBI__GCF_000745975.1:WP_035237791.1 3 TANENYNKLNASYLFADIAKRVQLYQDSNPDKEVIRLGIGDVTLPLPPAVVQGFQKGVDEMSADATFRG 71 57******************************************************************* PP TIGR03542 71 yGpeqGldllreaiaeeeykgr...idpeeifisdGakcdvarllelfgsdktvavqdPvyPvyvdsav 136 yGpeqG+ +lr+aia ++++r i+++eif+sdGakcd+++++elf+++ t+a+ dPvyPvy+d++v lcl|NCBI__GCF_000745975.1:WP_035237791.1 72 YGPEQGYLFLRQAIAAGDFQSRgadIEADEIFVSDGAKCDTGNFQELFSNNITIAIPDPVYPVYLDTNV 140 *********************999********************************************* PP TIGR03542 137 laGragvldddgkykkivylpctkenefiPelpeekkvdiiylCsPnnPtGtvltkeqlkelvdyaken 205 +aGr+g+++ dg+y+ ivy+ c+ken+f+P+lp+ + vd+iylC+PnnPtG+++t++ql ++v+ya++n lcl|NCBI__GCF_000745975.1:WP_035237791.1 141 MAGRTGEFK-DGRYQGIVYMDCLKENGFMPDLPDAP-VDLIYLCFPNNPTGSTATRDQLAAWVNYARDN 207 *****9997.69************************.******************************** PP TIGR03542 206 dslilfdaayeafisdpslPksiyeiegakecaieirsfsktlGftGvrlgytvvPkelkvedg....e 270 ++lilfdaayeafi+d +lP+siyei+gake+a+e+rsfskt+GftG+r+g+tvvPk ++ ++ lcl|NCBI__GCF_000745975.1:WP_035237791.1 208 KALILFDAAYEAFIRDTDLPRSIYEIPGAKEVAVEFRSFSKTAGFTGTRCGFTVVPKSCMIYTAsgskV 276 **********************************************************98877667778 PP TIGR03542 271 slkklWerllctkfnGaslivqraaeavlakeglqqikeaisyymenarilrkaleaaglkvyGGenaP 339 sl+++W+r+++tkfnG+s++vq+aaeav+++ g+ qik i+yy+ na+++ +++++ g+ GG+naP lcl|NCBI__GCF_000745975.1:WP_035237791.1 277 SLHNMWNRRQSTKFNGVSYPVQKAAEAVYSPGGQAQIKANIDYYLANAQVVCQTMTDLGFDHVGGKNAP 345 9******************************************************************** PP TIGR03542 340 ylWvklpegissedffdkllkeaevvgtPGsGfGssGeGfvrlsalgkredivealerike 400 y+W+ + g +s++ffd ll +a vv tPG+GfG++G ++r+sa+++ e++++a+ r+k+ lcl|NCBI__GCF_000745975.1:WP_035237791.1 346 YIWIDGN-GRDSWEFFDLLLDKAGVVCTPGQGFGRCGAQYIRISAFNSPENVAKAMARVKD 405 ****965.69************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (402 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory