Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_035240987.1 Q366_RS16540 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::Q9KRB0 (426 letters) >NCBI__GCF_000745975.1:WP_035240987.1 Length = 420 Score = 269 bits (687), Expect = 1e-76 Identities = 161/412 (39%), Positives = 231/412 (56%), Gaps = 8/412 (1%) Query: 16 VNLPGSKSVSNRALLLAALASGTTRLTNLLDSDDIRHMLNALTKLGVNYRLSADKTTCEV 75 V +PGSKS+S+R L+ +ALA G + + N+LDS DI AL +G + Sbjct: 14 VRIPGSKSISHRMLICSALAHGISEIYNVLDSQDISLTRKALECMGAQIESKTNSALVVT 73 Query: 76 EGLGQAFHTTQPLELFLGNAGTAMRPLAAALCLGQGDYVLTGEPRMKERPIGHLVDALRQ 135 G+ +P+ L GN+GT+MR LA LG Y LTG+ RM++RP+G L+DAL + Sbjct: 74 GFGGRPRPWAEPIHL--GNSGTSMRLLAGIAALGTTPYTLTGDERMRQRPMGELLDALGR 131 Query: 136 AGAQIEYLEQENFPPLRIQGTGLQAGTVTIDGSISSQFLTAFLMSAPLAQGKVTIKIVGE 195 E PP+ IQG G +D S SSQ+L+A LM+ + I + G Sbjct: 132 IRIHAGSQNNEGTPPVVIQGGDRAGGRTLLDCSRSSQYLSALLMAGAFFDQGLVIDLTGP 191 Query: 196 LVSKPYIDITLHIMEQFGVQVINHDYQEFVIPAGQSYVSPGQFLVEGDASSASYFLAAAA 255 VS+PYID+TL +M+QFGV + +P GQ+Y G+ VE D S+A YF AA A Sbjct: 192 AVSQPYIDLTLDVMKQFGVNAFRISDTCYEVPGGQTYTC-GKKSVEPDLSNAGYFWAAGA 250 Query: 256 IKGGEVKVTGIGKNSIQGDIQFADALEKMGAQIEWGDDYVIARR---GELNAVDLDFNHI 312 + G ++ V IG S+QGD++ A EKMG + D V+ + G L+ VD+D + Sbjct: 251 VTGADIGVDNIGTASLQGDLKQAYIFEKMGCTVN-RDGLVLRVKGGPGPLHGVDVDMSDT 309 Query: 313 PDAAMTIATTALFAKGTTAIRNVYNWRVKETDRLAAMATELRKVGATVEEGEDFIVITPP 372 PDA +A TA FA GTT I N+ + RVKE DR+ A+ ++L K+G +G DF+ IT Sbjct: 310 PDAVPAVAVTAAFATGTTRITNIGHLRVKECDRIDAVCSQLTKMGIKAVQGPDFMEITGG 369 Query: 373 TKLIHAAIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPDYFDKFAQL 424 T A I+T++DHR+AM F++ L + I +P C K+FP ++ F L Sbjct: 370 TP-HGAVIETFNDHRIAMAFAVAGLRVDGIKIENPVCVEKSFPTFWQLFNAL 420 Score = 28.5 bits (62), Expect = 4e-04 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Query: 15 EVNLPGSKSVSNRALLLAALASGTTRLTNL-----LDSDDIRHMLNALTKLGV 62 +V++ + + AA A+GTTR+TN+ + D I + + LTK+G+ Sbjct: 303 DVDMSDTPDAVPAVAVTAAFATGTTRITNIGHLRVKECDRIDAVCSQLTKMGI 355 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 426 Length of database: 420 Length adjustment: 32 Effective length of query: 394 Effective length of database: 388 Effective search space: 152872 Effective search space used: 152872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_035240987.1 Q366_RS16540 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.19169.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-136 438.8 0.0 1.1e-135 438.6 0.0 1.0 1 lcl|NCBI__GCF_000745975.1:WP_035240987.1 Q366_RS16540 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745975.1:WP_035240987.1 Q366_RS16540 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.6 0.0 1.1e-135 1.1e-135 3 411 .. 14 419 .. 12 420 .] 0.96 Alignments for each domain: == domain 1 score: 438.6 bits; conditional E-value: 1.1e-135 TIGR01356 3 ikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveee.keelviegvgglkepe 70 ++ipgsKSishR+l+ +aLa+g ++++n+L+s+D+ t +al+ +Ga++e++ + lv++g+gg +p lcl|NCBI__GCF_000745975.1:WP_035240987.1 14 VRIPGSKSISHRMLICSALAHGISEIYNVLDSQDISLTRKALECMGAQIESKtNSALVVTGFGGRPRPW 82 89************************************************555999*******955554 PP TIGR01356 71 .aeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlaisg 138 + ++lgnsGt++Rll g++al ++++ltgde++++RP+++l++aL ++ ++ s+++eg++P++i+g lcl|NCBI__GCF_000745975.1:WP_035240987.1 83 aEPIHLGNSGTSMRLLAGIAALGTTPYTLTGDERMRQRPMGELLDALGRIRIHAGSQNNEGTPPVVIQG 151 69*******************999********************************************* PP TIGR01356 139 p.lkggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeederk 206 + gg + l++s SsQy+sall+a++ +q+ + ++g + +s+pyi++tL+++k+fgv++ + ++ lcl|NCBI__GCF_000745975.1:WP_035240987.1 152 GdRAGGRTLLDCSRSSQYLSALLMAGAFFDQGLVIDLTG-PAVSQPYIDLTLDVMKQFGVNAFRISDTC 219 *6666**********************999999888888.*********************9988888* PP TIGR01356 207 ivvkggqkykqkevevegDaSsAafflaaaaitgeevtvenlgenstqgdkaiiivLeemGadveveeq 275 + v+ggq+y++ + +ve D+S+A +f aa+a+tg ++ v n+g++s+qgd + ++++e+mG++v+++ lcl|NCBI__GCF_000745975.1:WP_035240987.1 220 YEVPGGQTYTCGKKSVEPDLSNAGYFWAAGAVTGADIGVDNIGTASLQGDLKQAYIFEKMGCTVNRDGL 288 ********************************************************************* PP TIGR01356 276 rdveveg.asklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLeklG 343 ++v+g + l+gv+ +d+++++D++p++av aafA g+tri+ni +lRvkE+dRi a++++L+k+G lcl|NCBI__GCF_000745975.1:WP_035240987.1 289 -VLRVKGgPGPLHGVD--VDMSDTPDAVPAVAVTAAFATGTTRITNIGHLRVKECDRIDAVCSQLTKMG 354 .7****9888999999..*************************************************** PP TIGR01356 344 veveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfevleq 411 +++ +++d+++i+G+ + +gav++t++DHRiama+av+gl+++ +++ie++ cv+ksfP F+++ ++ lcl|NCBI__GCF_000745975.1:WP_035240987.1 355 IKAVQGPDFMEITGG--TPHGAVIETFNDHRIAMAFAVAGLRVD-GIKIENPVCVEKSFPTFWQLFNA 419 ***************..6*************************9.*******************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 9.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory