Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate WP_035534945.1 HALAL_RS0104400 amidohydrolase
Query= curated2:Q836H7 (378 letters) >NCBI__GCF_000527155.1:WP_035534945.1 Length = 397 Score = 178 bits (451), Expect = 3e-49 Identities = 113/373 (30%), Positives = 189/373 (50%), Gaps = 17/373 (4%) Query: 8 ELIAIRRQLHQIPEIGLEEKETQAFLLNEIDKMKQPYLQVRTWQTGILVFIEGKNPQKTI 67 +L+ +RR +H P + +E++T A++ D++++ L+ G + + + + I Sbjct: 20 DLVRVRRHIHANPRLSRQEQDTAAYVA---DELREAGLKPEMIPDGTGLTCDIGDGDQVI 76 Query: 68 GWRADIDGLPIQEEVVSAFQSKRPGFMHACGHDFHMTIGLGVLKEL----SQQQPDNNFL 123 RAD+D LPI + ++S G HACGHD H +I LGV K L ++ + F Sbjct: 77 AIRADMDALPIHDPKQVPYRSTVDGVCHACGHDAHTSIVLGVGKVLGALAARGELHGRFR 136 Query: 124 FLFQPAEENEAGGMLMYEDHAFGEWLPDEFYALHVNPDLPVGTISTRVGTLFAATCEVNI 183 +FQP+EE G H + + F A H +P+ G + R G L AA + + Sbjct: 137 LIFQPSEERFPSGAPTMIKHGALQDVSAAF-AFHCDPNFLAGQVGIRNGGLTAACDLMEV 195 Query: 184 TLKGKGGHAAFPHQANDMVLAATNLIQQAQTIVSRNVDPVVGAVVTFGTFHAGTACNVIA 243 + G+GGH + PH D+ A + ++ + +IV+R +DP + FG+ AG A N I Sbjct: 196 NMTGRGGHTSRPHLTTDLCDAISRVVVEVPSIVNRLLDPRQNVAIVFGSVQAGEAANAIP 255 Query: 244 EEATLSGTIRTLTAETNEQTQRRIREISEGIAQS--FQCEVTVHLDQKGYLPVVNEPACT 301 ++A+ TIR E +E+ R +++++ +A + C++T +G PVVN+ + Sbjct: 256 QKASAKATIRMQGREMSEEVPRLVQDVTRNVAAAAGATCDITY---TRGVPPVVNDRSAA 312 Query: 302 TNFIEYMSKQ-ATVQFQQAPVAMTGEDFGYLLSKVPGTMFWLGVASP---YSLHSAKFEP 357 F S +AP +M GEDF Y L +VPG M LGV P +H F+ Sbjct: 313 ATFAGATSAALGQHAVAEAPASMGGEDFAYYLEQVPGAMARLGVGRPGEKLDIHQGNFDI 372 Query: 358 NEEALLFGVEAVS 370 +E+AL +GV ++ Sbjct: 373 DEKALAYGVRVMT 385 Lambda K H 0.319 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 397 Length adjustment: 30 Effective length of query: 348 Effective length of database: 367 Effective search space: 127716 Effective search space used: 127716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory