Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_035629193.1 P166_RS0101660 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_000711315.1:WP_035629193.1 Length = 291 Score = 360 bits (924), Expect = e-104 Identities = 180/291 (61%), Positives = 223/291 (76%) Query: 1 MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60 M GSMVALVTP A +D+ +L L++ H++ T AIVAVGTTGESATLD EEH +V+ Sbjct: 1 MFRGSMVALVTPMLADESVDFAALENLIELHVKSKTKAIVAVGTTGESATLDFEEHCKVV 60 Query: 61 RRVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFR 120 R VV++ GRIPVIAGTGANST EA+ LT+ AK GADACLLVTPYYNKPTQEG+Y H++ Sbjct: 61 RFVVEKAAGRIPVIAGTGANSTSEAIELTQCAKDAGADACLLVTPYYNKPTQEGLYLHYK 120 Query: 121 HIAEAVAIPQILYNVPGRTSCDMLPETVERLSKVPNIIGIKEATGDLQRAKEVIERVGKD 180 +AE V IPQILYNVPGRT+CD+LPETV RL+ + NIIGIKEATGDL R ++ V D Sbjct: 121 KVAETVDIPQILYNVPGRTACDLLPETVGRLASIKNIIGIKEATGDLSRVAKIKALVPDD 180 Query: 181 FLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMPLH 240 F +Y+GDDAT +E +LLGG G ISVTANVAP M++ A+ G+A A+A++ ++ LH Sbjct: 181 FDLYTGDDATGIEFVLLGGHGTISVTANVAPAIMAEAFDEALAGNAEKAKALDAKVAGLH 240 Query: 241 KALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 LF+E+NPIPVKWA+ EMGLI IRLP+T LSP HE +RQA++ GVL Sbjct: 241 SKLFVEANPIPVKWAMTEMGLIGSAIRLPMTPLSPAYHEEVRQALKTAGVL 291 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_035629193.1 P166_RS0101660 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.18142.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-118 380.6 0.2 1.9e-118 380.4 0.2 1.0 1 lcl|NCBI__GCF_000711315.1:WP_035629193.1 P166_RS0101660 4-hydroxy-tetrahy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000711315.1:WP_035629193.1 P166_RS0101660 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 380.4 0.2 1.9e-118 1.9e-118 2 285 .. 5 287 .. 4 288 .. 0.99 Alignments for each domain: == domain 1 score: 380.4 bits; conditional E-value: 1.9e-118 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpv 70 +++Al+TP+ +d+svdfaale+lie ++++++ aiv+vGtTGEsatL +eE+ kv++++ve +++r+pv lcl|NCBI__GCF_000711315.1:WP_035629193.1 5 SMVALVTPMLADESVDFAALENLIELHVKSKTKAIVAVGTTGESATLDFEEHCKVVRFVVEKAAGRIPV 73 799****************************************************************** PP TIGR00674 71 iaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvs 139 iaGtg+n+t+eaielt+ a+++g+d++l+vtPyYnkPtqeGly h+k++ae+v++P+ilYnvP+Rt+++ lcl|NCBI__GCF_000711315.1:WP_035629193.1 74 IAGTGANSTSEAIELTQCAKDAGADACLLVTPYYNKPTQEGLYLHYKKVAETVDIPQILYNVPGRTACD 142 ********************************************************************* PP TIGR00674 140 lepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvap 208 l petv rLa+ ++i++iKea+gdl+rv +ika +++df +++GdDa+ e+++lG++G iSV++nvap lcl|NCBI__GCF_000711315.1:WP_035629193.1 143 LLPETVGRLASIKNIIGIKEATGDLSRVAKIKALVPDDFDLYTGDDATGIEFVLLGGHGTISVTANVAP 211 ********************************************************************* PP TIGR00674 209 kelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekke 277 ++e +al+g+ e+a+ +++k l+++lf+e+NPipvK+a++ +gli + ++RlP+t+ls +e lcl|NCBI__GCF_000711315.1:WP_035629193.1 212 AIMAEAFDEALAGNAEKAKALDAKVAGLHSKLFVEANPIPVKWAMTEMGLIGS-AIRLPMTPLSPAYHE 279 ****************************************************9.*************** PP TIGR00674 278 klkevlke 285 +++++lk+ lcl|NCBI__GCF_000711315.1:WP_035629193.1 280 EVRQALKT 287 ****9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.16 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory