Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_036257785.1 DL86_RS02895 1-aminocyclopropane-1-carboxylate deaminase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000746085.1:WP_036257785.1 Length = 396 Score = 156 bits (395), Expect = 8e-43 Identities = 116/384 (30%), Positives = 172/384 (44%), Gaps = 20/384 (5%) Query: 4 LSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK 63 +SRR + P + V A A QG D++ L GEP P V+EAA AL + Sbjct: 17 ISRRSN-VAPFMALDVLANARRREAQGQDIIHLEIGEPGSPPPRAVREAAMAALDGRRIG 75 Query: 64 YAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSP 123 Y G P LRE +A +R GL+V PE +VT G F ++ D G V + +P Sbjct: 76 YTEALGRPSLRERIARHYRDAYGLAVAPEHIVVTNGSSGGFLLAFLSLFDAGARVAIAAP 135 Query: 124 YWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTK--ALVVNSPNNPTGAVY 181 + +Y ++ G V +E FV P + A+ +T+ +++ SP NP+G + Sbjct: 136 GYPAYRNILEALGIETVTIEVSEATRFVVTPSMI-EAVHAKTRLDGILLMSPANPSGTMM 194 Query: 182 PKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPE---HTLTVNGAAKAFAM 238 E L + +SDE+Y L Y P R A E + N +K F M Sbjct: 195 SAEALRDVCAACERLGVAFISDEVYHGLTYG----QPARTALEFSSEVIVANSFSKYFCM 250 Query: 239 TGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRR 298 TGWRIG+ P +++ + + S ++Q QE ++ Y R Sbjct: 251 TGWRIGWLVLPGHMVRTVERLQQNLAVSVGLLSQIGAEAVFDAQED----LQRVLSGYAR 306 Query: 299 RRDLLLEGLTALGLKAVRP-SGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDF-- 354 R +LL L +GL P GAFY+ +D S + D ++L E GVA PG DF Sbjct: 307 NRAILLNELPDMGLGGFHPVDGAFYIYVDVSRLTDDSGHFCAKMLDEIGVAATPGLDFDR 366 Query: 355 -AAFGHVRLSYATSEENLRKALER 377 G VR S+A E ++ +A+ R Sbjct: 367 TRGRGAVRFSFAGPEGDIVEAMRR 390 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 396 Length adjustment: 31 Effective length of query: 354 Effective length of database: 365 Effective search space: 129210 Effective search space used: 129210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory